Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	308
Gene name	Annexin A5
Gene symbol	ANXA5
Synonyms (NCBI Gene)	ANX5CPB-IENX2HEL-S-7PP4RPRGL3VAC-alph
Chromosome	4
Chromosome location	4q27
Summary	The Annexin 5 gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.The protein encoded by this gene belongs to the annexin family of calcium-dependent p

313

Show/Hide all (313)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022801	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT029721	hsa-miR-26b-5p	Microarray	19088304
MIRT038248	hsa-miR-330-5p	CLASH	23622248
MIRT545134	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT545135	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT545133	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT545132	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT545131	hsa-miR-6819-3p	PAR-CLIP	21572407
MIRT545130	hsa-miR-6877-3p	PAR-CLIP	21572407
MIRT545129	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT329269	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545128	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT545127	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT545126	hsa-miR-4755-3p	PAR-CLIP	21572407
MIRT545125	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT545123	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT545124	hsa-miR-3148	PAR-CLIP	21572407
MIRT545122	hsa-miR-6124	PAR-CLIP	21572407
MIRT329265	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545121	hsa-miR-4435	PAR-CLIP	21572407
MIRT545134	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT545135	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT545133	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT545132	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT545131	hsa-miR-6819-3p	PAR-CLIP	21572407
MIRT545130	hsa-miR-6877-3p	PAR-CLIP	21572407
MIRT545129	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT329269	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT545128	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT545127	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT545126	hsa-miR-4755-3p	PAR-CLIP	21572407
MIRT545125	hsa-miR-2682-3p	PAR-CLIP	21572407
MIRT545123	hsa-miR-6781-3p	PAR-CLIP	21572407
MIRT545124	hsa-miR-3148	PAR-CLIP	21572407
MIRT545122	hsa-miR-6124	PAR-CLIP	21572407
MIRT329265	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT545121	hsa-miR-4435	PAR-CLIP	21572407
MIRT786541	hsa-miR-1278	CLIP-seq
MIRT786542	hsa-miR-2681	CLIP-seq
MIRT786543	hsa-miR-29a	CLIP-seq
MIRT786544	hsa-miR-29b	CLIP-seq
MIRT786545	hsa-miR-29c	CLIP-seq
MIRT786546	hsa-miR-3120-3p	CLIP-seq
MIRT786547	hsa-miR-3143	CLIP-seq
MIRT786548	hsa-miR-383	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT786551	hsa-miR-4274	CLIP-seq
MIRT786552	hsa-miR-4311	CLIP-seq
MIRT786553	hsa-miR-4666-3p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT786555	hsa-miR-4775	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT786557	hsa-miR-5095	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT786559	hsa-miR-543	CLIP-seq
MIRT786560	hsa-miR-548a-5p	CLIP-seq
MIRT786561	hsa-miR-548ab	CLIP-seq
MIRT786562	hsa-miR-548ak	CLIP-seq
MIRT786563	hsa-miR-548b-5p	CLIP-seq
MIRT786564	hsa-miR-548c-5p	CLIP-seq
MIRT786565	hsa-miR-548d-5p	CLIP-seq
MIRT786566	hsa-miR-548h	CLIP-seq
MIRT786567	hsa-miR-548i	CLIP-seq
MIRT786568	hsa-miR-548j	CLIP-seq
MIRT786569	hsa-miR-548k	CLIP-seq
MIRT786570	hsa-miR-548l	CLIP-seq
MIRT786571	hsa-miR-548w	CLIP-seq
MIRT786572	hsa-miR-548y	CLIP-seq
MIRT786573	hsa-miR-552	CLIP-seq
MIRT786574	hsa-miR-559	CLIP-seq
MIRT786575	hsa-miR-590-3p	CLIP-seq
MIRT786576	hsa-miR-802	CLIP-seq
MIRT786547	hsa-miR-3143	CLIP-seq
MIRT1545428	hsa-miR-3714	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT786559	hsa-miR-543	CLIP-seq
MIRT786560	hsa-miR-548a-5p	CLIP-seq
MIRT786561	hsa-miR-548ab	CLIP-seq
MIRT786562	hsa-miR-548ak	CLIP-seq
MIRT786563	hsa-miR-548b-5p	CLIP-seq
MIRT786564	hsa-miR-548c-5p	CLIP-seq
MIRT786565	hsa-miR-548d-5p	CLIP-seq
MIRT786566	hsa-miR-548h	CLIP-seq
MIRT786567	hsa-miR-548i	CLIP-seq
MIRT786568	hsa-miR-548j	CLIP-seq
MIRT786569	hsa-miR-548k	CLIP-seq
MIRT786570	hsa-miR-548l	CLIP-seq
MIRT786571	hsa-miR-548w	CLIP-seq
MIRT786572	hsa-miR-548y	CLIP-seq
MIRT786574	hsa-miR-559	CLIP-seq
MIRT1555954	hsa-miR-1293	CLIP-seq
MIRT1555955	hsa-miR-342-5p	CLIP-seq
MIRT1555956	hsa-miR-4269	CLIP-seq
MIRT1555957	hsa-miR-4483	CLIP-seq
MIRT1555958	hsa-miR-4651	CLIP-seq
MIRT1555959	hsa-miR-4664-5p	CLIP-seq
MIRT1555960	hsa-miR-608	CLIP-seq
MIRT1931989	hsa-miR-105	CLIP-seq
MIRT1931990	hsa-miR-1252	CLIP-seq
MIRT786541	hsa-miR-1278	CLIP-seq
MIRT1931991	hsa-miR-1301	CLIP-seq
MIRT1931992	hsa-miR-18a	CLIP-seq
MIRT1931993	hsa-miR-18b	CLIP-seq
MIRT1931994	hsa-miR-214	CLIP-seq
MIRT1931995	hsa-miR-2682	CLIP-seq
MIRT1931996	hsa-miR-297	CLIP-seq
MIRT786546	hsa-miR-3120-3p	CLIP-seq
MIRT786547	hsa-miR-3143	CLIP-seq
MIRT1931997	hsa-miR-3146	CLIP-seq
MIRT1555955	hsa-miR-342-5p	CLIP-seq
MIRT1931998	hsa-miR-34a	CLIP-seq
MIRT1931999	hsa-miR-34c-5p	CLIP-seq
MIRT1932000	hsa-miR-3619-5p	CLIP-seq
MIRT1545428	hsa-miR-3714	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT1555956	hsa-miR-4269	CLIP-seq
MIRT1932001	hsa-miR-4270	CLIP-seq
MIRT786551	hsa-miR-4274	CLIP-seq
MIRT1932002	hsa-miR-4300	CLIP-seq
MIRT786552	hsa-miR-4311	CLIP-seq
MIRT1932003	hsa-miR-4441	CLIP-seq
MIRT1932004	hsa-miR-4476	CLIP-seq
MIRT1932005	hsa-miR-449a	CLIP-seq
MIRT1932006	hsa-miR-449b	CLIP-seq
MIRT1932007	hsa-miR-449c	CLIP-seq
MIRT1932008	hsa-miR-4509	CLIP-seq
MIRT1555958	hsa-miR-4651	CLIP-seq
MIRT1932009	hsa-miR-4659a-3p	CLIP-seq
MIRT1932010	hsa-miR-4659b-3p	CLIP-seq
MIRT1932011	hsa-miR-4660	CLIP-seq
MIRT1555959	hsa-miR-4664-5p	CLIP-seq
MIRT786553	hsa-miR-4666-3p	CLIP-seq
MIRT1932012	hsa-miR-4720-5p	CLIP-seq
MIRT1932013	hsa-miR-4735-3p	CLIP-seq
MIRT1932014	hsa-miR-4757-3p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT786555	hsa-miR-4775	CLIP-seq
MIRT1932015	hsa-miR-4799-3p	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT1932016	hsa-miR-5047	CLIP-seq
MIRT786557	hsa-miR-5095	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT786559	hsa-miR-543	CLIP-seq
MIRT786560	hsa-miR-548a-5p	CLIP-seq
MIRT786561	hsa-miR-548ab	CLIP-seq
MIRT786562	hsa-miR-548ak	CLIP-seq
MIRT786563	hsa-miR-548b-5p	CLIP-seq
MIRT786564	hsa-miR-548c-5p	CLIP-seq
MIRT786565	hsa-miR-548d-5p	CLIP-seq
MIRT786566	hsa-miR-548h	CLIP-seq
MIRT786567	hsa-miR-548i	CLIP-seq
MIRT786568	hsa-miR-548j	CLIP-seq
MIRT786569	hsa-miR-548k	CLIP-seq
MIRT786570	hsa-miR-548l	CLIP-seq
MIRT1932017	hsa-miR-548m	CLIP-seq
MIRT786571	hsa-miR-548w	CLIP-seq
MIRT786572	hsa-miR-548y	CLIP-seq
MIRT786573	hsa-miR-552	CLIP-seq
MIRT786574	hsa-miR-559	CLIP-seq
MIRT1932018	hsa-miR-567	CLIP-seq
MIRT786575	hsa-miR-590-3p	CLIP-seq
MIRT1555960	hsa-miR-608	CLIP-seq
MIRT1932019	hsa-miR-761	CLIP-seq
MIRT1932020	hsa-miR-920	CLIP-seq
MIRT2172428	hsa-miR-1236	CLIP-seq
MIRT1931990	hsa-miR-1252	CLIP-seq
MIRT786541	hsa-miR-1278	CLIP-seq
MIRT1555954	hsa-miR-1293	CLIP-seq
MIRT1931994	hsa-miR-214	CLIP-seq
MIRT1931995	hsa-miR-2682	CLIP-seq
MIRT1931996	hsa-miR-297	CLIP-seq
MIRT786543	hsa-miR-29a	CLIP-seq
MIRT786544	hsa-miR-29b	CLIP-seq
MIRT786545	hsa-miR-29c	CLIP-seq
MIRT786546	hsa-miR-3120-3p	CLIP-seq
MIRT786547	hsa-miR-3143	CLIP-seq
MIRT2172429	hsa-miR-3152-3p	CLIP-seq
MIRT1555955	hsa-miR-342-5p	CLIP-seq
MIRT1931998	hsa-miR-34a	CLIP-seq
MIRT1931999	hsa-miR-34c-5p	CLIP-seq
MIRT1932000	hsa-miR-3619-5p	CLIP-seq
MIRT1545428	hsa-miR-3714	CLIP-seq
MIRT786548	hsa-miR-383	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT1555956	hsa-miR-4269	CLIP-seq
MIRT1932001	hsa-miR-4270	CLIP-seq
MIRT786551	hsa-miR-4274	CLIP-seq
MIRT1932002	hsa-miR-4300	CLIP-seq
MIRT786552	hsa-miR-4311	CLIP-seq
MIRT1932003	hsa-miR-4441	CLIP-seq
MIRT2172430	hsa-miR-4462	CLIP-seq
MIRT1932004	hsa-miR-4476	CLIP-seq
MIRT1555957	hsa-miR-4483	CLIP-seq
MIRT1932005	hsa-miR-449a	CLIP-seq
MIRT1932006	hsa-miR-449b	CLIP-seq
MIRT1932007	hsa-miR-449c	CLIP-seq
MIRT2172431	hsa-miR-4503	CLIP-seq
MIRT1555958	hsa-miR-4651	CLIP-seq
MIRT1932009	hsa-miR-4659a-3p	CLIP-seq
MIRT1932010	hsa-miR-4659b-3p	CLIP-seq
MIRT1555959	hsa-miR-4664-5p	CLIP-seq
MIRT1932012	hsa-miR-4720-5p	CLIP-seq
MIRT1932014	hsa-miR-4757-3p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT1932015	hsa-miR-4799-3p	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT786559	hsa-miR-543	CLIP-seq
MIRT1932018	hsa-miR-567	CLIP-seq
MIRT1555960	hsa-miR-608	CLIP-seq
MIRT1932019	hsa-miR-761	CLIP-seq
MIRT1932020	hsa-miR-920	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT1931989	hsa-miR-105	CLIP-seq
MIRT1931990	hsa-miR-1252	CLIP-seq
MIRT1931991	hsa-miR-1301	CLIP-seq
MIRT1931992	hsa-miR-18a	CLIP-seq
MIRT1931993	hsa-miR-18b	CLIP-seq
MIRT786542	hsa-miR-2681	CLIP-seq
MIRT1931995	hsa-miR-2682	CLIP-seq
MIRT786547	hsa-miR-3143	CLIP-seq
MIRT1555955	hsa-miR-342-5p	CLIP-seq
MIRT1931998	hsa-miR-34a	CLIP-seq
MIRT1931999	hsa-miR-34c-5p	CLIP-seq
MIRT1545428	hsa-miR-3714	CLIP-seq
MIRT786549	hsa-miR-3920	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT2426366	hsa-miR-409-5p	CLIP-seq
MIRT1932004	hsa-miR-4476	CLIP-seq
MIRT1932005	hsa-miR-449a	CLIP-seq
MIRT1932006	hsa-miR-449b	CLIP-seq
MIRT1932007	hsa-miR-449c	CLIP-seq
MIRT1932008	hsa-miR-4509	CLIP-seq
MIRT1555958	hsa-miR-4651	CLIP-seq
MIRT1932011	hsa-miR-4660	CLIP-seq
MIRT1555959	hsa-miR-4664-5p	CLIP-seq
MIRT786553	hsa-miR-4666-3p	CLIP-seq
MIRT1932013	hsa-miR-4735-3p	CLIP-seq
MIRT786554	hsa-miR-4762-3p	CLIP-seq
MIRT786555	hsa-miR-4775	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT1932016	hsa-miR-5047	CLIP-seq
MIRT786557	hsa-miR-5095	CLIP-seq
MIRT786558	hsa-miR-513b	CLIP-seq
MIRT2426367	hsa-miR-520d-5p	CLIP-seq
MIRT2426368	hsa-miR-524-5p	CLIP-seq
MIRT786559	hsa-miR-543	CLIP-seq
MIRT786560	hsa-miR-548a-5p	CLIP-seq
MIRT786561	hsa-miR-548ab	CLIP-seq
MIRT786562	hsa-miR-548ak	CLIP-seq
MIRT786563	hsa-miR-548b-5p	CLIP-seq
MIRT786564	hsa-miR-548c-5p	CLIP-seq
MIRT786565	hsa-miR-548d-5p	CLIP-seq
MIRT786566	hsa-miR-548h	CLIP-seq
MIRT786567	hsa-miR-548i	CLIP-seq
MIRT786568	hsa-miR-548j	CLIP-seq
MIRT786569	hsa-miR-548k	CLIP-seq
MIRT786570	hsa-miR-548l	CLIP-seq
MIRT1932017	hsa-miR-548m	CLIP-seq
MIRT786571	hsa-miR-548w	CLIP-seq
MIRT786572	hsa-miR-548y	CLIP-seq
MIRT786573	hsa-miR-552	CLIP-seq
MIRT786574	hsa-miR-559	CLIP-seq
MIRT786575	hsa-miR-590-3p	CLIP-seq
MIRT1555960	hsa-miR-608	CLIP-seq
MIRT1931989	hsa-miR-105	CLIP-seq
MIRT1931990	hsa-miR-1252	CLIP-seq
MIRT1931991	hsa-miR-1301	CLIP-seq
MIRT1931992	hsa-miR-18a	CLIP-seq
MIRT1931993	hsa-miR-18b	CLIP-seq
MIRT1932004	hsa-miR-4476	CLIP-seq
MIRT1932008	hsa-miR-4509	CLIP-seq
MIRT1932011	hsa-miR-4660	CLIP-seq
MIRT1932013	hsa-miR-4735-3p	CLIP-seq
MIRT1932016	hsa-miR-5047	CLIP-seq
MIRT1932017	hsa-miR-548m	CLIP-seq
MIRT1931989	hsa-miR-105	CLIP-seq
MIRT1931990	hsa-miR-1252	CLIP-seq
MIRT1555954	hsa-miR-1293	CLIP-seq
MIRT1931991	hsa-miR-1301	CLIP-seq
MIRT1931992	hsa-miR-18a	CLIP-seq
MIRT1931993	hsa-miR-18b	CLIP-seq
MIRT1931995	hsa-miR-2682	CLIP-seq
MIRT1555955	hsa-miR-342-5p	CLIP-seq
MIRT1931998	hsa-miR-34a	CLIP-seq
MIRT1931999	hsa-miR-34c-5p	CLIP-seq
MIRT1545428	hsa-miR-3714	CLIP-seq
MIRT786550	hsa-miR-3922-5p	CLIP-seq
MIRT1932004	hsa-miR-4476	CLIP-seq
MIRT1555957	hsa-miR-4483	CLIP-seq
MIRT1932005	hsa-miR-449a	CLIP-seq
MIRT1932006	hsa-miR-449b	CLIP-seq
MIRT1932007	hsa-miR-449c	CLIP-seq
MIRT1932008	hsa-miR-4509	CLIP-seq
MIRT1555958	hsa-miR-4651	CLIP-seq
MIRT1932011	hsa-miR-4660	CLIP-seq
MIRT1555959	hsa-miR-4664-5p	CLIP-seq
MIRT1932013	hsa-miR-4735-3p	CLIP-seq
MIRT786556	hsa-miR-498	CLIP-seq
MIRT1932016	hsa-miR-5047	CLIP-seq
MIRT1932017	hsa-miR-548m	CLIP-seq
MIRT1555960	hsa-miR-608	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IEA
GO:0004859	Function	Phospholipase inhibitor activity	TAS	2967495
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 32296183, 32814053
GO:0005543	Function	Phospholipid binding	TAS	2967291
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0012506	Component	Vesicle membrane	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0042383	Component	Sarcolemma	IBA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0050819	Process	Negative regulation of coagulation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 21362503, 23533145
GO:0072563	Component	Endothelial microparticle	IEA

MIM	HGNC	e!Ensembl
131230	543	ENSG00000164111

P08758

Protein name

Annexin A5 (Anchorin CII) (Annexin V) (Annexin-5) (Calphobindin I) (CPB-I) (Endonexin II) (Lipocortin V) (Placental anticoagulant protein 4) (PP4) (Placental anticoagulant protein I) (PAP-I) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-a

Protein function

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

PDB

1ANW , 1ANX , 1AVH , 1AVR , 1HAK , 1HVD , 1HVE , 1HVF , 1HVG , 1SAV , 2XO2 , 2XO3 , 6K22 , 6K25 , 8GYC , 8H0J , 8H9Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	19 → 84	Annexin	Family
PF00191	Annexin	91 → 156	Annexin	Family
PF00191	Annexin	174 → 240	Annexin	Family
PF00191	Annexin	250 → 315	Annexin	Family

Sequence

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF
QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
KGDTSGDYKKALLLLCGEDD

Sequence length

320

Interactions

View interactions

	Reactome
			Platelet degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXA5-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES OF THE NERVOUS SYSTEM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pregnancy loss, recurrent, susceptibility to, 3	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (289)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
5q-syndrome	5q-syndrome	BEFREE	12163050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10071131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28393472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15526283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19461527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	19461527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	19381893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28490010, 29901668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29675370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10071131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	30694461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	25323007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32301581, 33049317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26083568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31861978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28911832, 8883264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	24339880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	10928466, 11108960, 16449315, 27638930, 28000012, 28393472, 30922166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	16449315, 21871597, 22288586, 23529182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22226179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22341596, 25525746, 29267398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	9014583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33482886, 9014583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30182154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	BEFREE	29407546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22341596, 25525746, 29267398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28592134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	28393472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24423325, 26869017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	28960523		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23985699, 28024916, 28560420, 29943471, 30106144, 30106156, 30651766		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15897243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barth Syndrome	Barth syndrome	Pubtator	14764526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28326169		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	30028953	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	8883264		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	9233563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	8883264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23908596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	26017281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	9233563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	28235427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21546157, 24098491, 25064703, 28450532, 28904004, 29466981, 29721043, 30140694, 31266224, 31349522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12698200, 16294023, 16417648, 28076321, 31266224, 33369470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	8068938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	27353274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcium pyrophosphate deposition disease	Chondrocalcinosis	BEFREE	11764218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30010106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12959682, 19461527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	29633253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24761872, 29969781, 37117324, 37679418, 38049741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15289875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22484852, 23152000, 24521149, 26197988, 28623135, 29784046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17401092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30197345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17401092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	17401092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	15840037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25525746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	25525746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10903884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15289875, 30010106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30010106, 7672695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	24260303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10071131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23887863, 28429360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28429360, 35790790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	9136073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11718571, 31081972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23616621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10071131, 15897243, 21733558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASDB_DG	21685187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	21685187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28607529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	17766279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28333149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28490010, 29093625, 29466981, 29949153, 31440877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19461527, 26078938, 28694750, 29344237, 30588113, 30909473, 31525661, 31717557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26495974, 29093625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	29803980, 31802427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15481442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28429360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	10701682, 20542876, 27906841, 9515022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28393205, 28558682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20124049, 29712962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24339880, 29130961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24339880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	12200370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17869070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17869070	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18773956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11764218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22970290	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27353274	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28592134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27612088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24423325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28592134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	29497952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25323007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	31731057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31772502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	Pubtator	39350328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24140079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22459351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29282044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34036378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	29282044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	15280416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29443940, 30362638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31070527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	19282655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16402362, 26589942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29914056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31188231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24805821, 25245332, 31011934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25226230, 25245332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24805821, 25245332, 30599912, 31011934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16432159, 27255231, 28233371, 30078202, 30536196, 31016407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30531680, 34512630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	24581426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	10071131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	26160872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	17766279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17766279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	10701682, 20542876, 27906841, 9515022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10701682, 17401092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	27513568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	12200370, 33370471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	21751376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	37272842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	21751376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16294023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28972431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16213748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25525746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19681808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25525746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	29694681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17766279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29095261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27906841, 29095261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	29095261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	15493013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29394093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22707614, 26160872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	18097533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32535589	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	12200370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	25495894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10701682, 15840037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23616621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	39302398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26883008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	27906841, 29095261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	24214631	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15632192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24962166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	22363452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10940651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19372761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	22170698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26055142, 26462627, 26615672, 29802377, 31597595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28607529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25854406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	19004141, 28216071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10225817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30922166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26615672, 29802377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29093625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10071131, 16076491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	28024916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19716854, 28024916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28024916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	18349030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21546157, 24098491, 25064703, 28450532, 28904004, 29466981, 29721043, 30140694, 31266224, 31349522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	20855888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	15289875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29805529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22484852, 23152000, 24521149, 28623135, 29784046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30197345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19488907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26503559, 29088783, 29129513, 29164150, 30295086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20494139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31496696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11471572, 11746086, 19372761, 24098491, 24356445, 26615672, 28713162, 29088864, 29089230, 29093625, 29386219, 29522835, 29581781, 29587668, 29802377 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28490010, 29093625, 29466981, 29949153, 31440877		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11221862, 24743186, 27338298, 28490010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11231317, 24743186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	26083568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16449315, 23850300, 23899942, 27418639, 27638930, 28900802, 29497952, 30196743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	27827950	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	10071131, 12842991, 16467200, 16490592, 28328317, 28763493, 29018054, 29472861, 30114708, 31558292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34639102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11698494		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUSCULAR DYSTROPHY, LIMB-GIRDLE, TYPE 2B	Limb-Girdle Muscular Dystrophy	BEFREE	27286750		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15481442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	12163050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21720708, 22975581		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	20814891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12200370, 31468674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12200370, 17408414		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	12200370	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	20124049, 29712962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	27286750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18384219, 32101017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22059741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	LHGDN	18384219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11746086, 11953889, 24124368, 24216163, 32277653, 40711670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14744786, 16195337, 18653704, 19461527, 19509158, 19584166, 20039326, 21390189, 21785270, 21902545, 22903146, 22971941, 23319823, 24098491, 24356445 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	23142971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15345369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15774829, 29977157, 30389710, 31368498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27310305, 30145925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	31190166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	14710359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28854422, 29089230, 29438228, 29607921, 30773645, 31269698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	32964764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30197345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30197345, 31474227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19488907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32921986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29553126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26083568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	31772502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	26321864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	23498654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	11991237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	10928466, 16449315, 28393472, 29096830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26503559, 29088783, 29129513, 29164150, 29238471, 30295086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30587522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26160872, 30182154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	26869017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	20855888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28393205, 28558682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	30161025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23711145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31098787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26055407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28784104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scott Syndrome	Scott Syndrome	BEFREE	22027759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	26495974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	24969051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	22384858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	15531296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	22872639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28130736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	33187495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30599074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17622245, 23319823, 24022190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15714205, 34599215, 36708578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16449678, 29856687, 31014274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	15493013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20494139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15259061, 15334700, 16367923, 29619675, 34490480, 37904473, 38287304	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	35912732, 40124374	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	22615882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	30028953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	11991237, 15271793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	15271793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	22635237, 23498654, 28108842, 28900802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	28108842, 28900802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	22103678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	16704958, 25684211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22275472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31496696, 31814886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	29250672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31496696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22275472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30152053, 30504391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32174262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	16780590, 23374291, 31502558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22027750, 30010106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	9920419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	25684211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	12200370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	10701682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	24912431		★★★★★ ★☆☆☆☆ Found in Text Mining only

ANXA5 (annexin A5)