Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	307
Gene name	Annexin A4
Gene symbol	ANXA4
Synonyms (NCBI Gene)	ANX4HEL-S-274P32.5PAP-IIPIG28PP4-XZAP36
Chromosome	2
Chromosome location	2p13.3
Summary	Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocyto

185

Show/Hide all (185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT025331	hsa-miR-34a-5p	Proteomics	21566225
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT624732	hsa-miR-548u	HITS-CLIP	23824327
MIRT624731	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT624730	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT624729	hsa-miR-8061	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	27418678
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT576961	hsa-miR-8061	HITS-CLIP	27418678
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT635253	hsa-miR-3134	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT576964	hsa-miR-548u	HITS-CLIP	23824327
MIRT576962	hsa-miR-7161-5p	HITS-CLIP	23824327
MIRT576963	hsa-miR-4760-5p	HITS-CLIP	23824327
MIRT576961	hsa-miR-8061	HITS-CLIP	23824327
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786508	hsa-miR-1305	CLIP-seq
MIRT786509	hsa-miR-1324	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786511	hsa-miR-3148	CLIP-seq
MIRT786512	hsa-miR-3149	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786514	hsa-miR-3171	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786517	hsa-miR-3609	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT786521	hsa-miR-369-3p	CLIP-seq
MIRT786522	hsa-miR-374c	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT786524	hsa-miR-421	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT786528	hsa-miR-4668-5p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT786532	hsa-miR-548ah	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786534	hsa-miR-548t	CLIP-seq
MIRT786535	hsa-miR-568	CLIP-seq
MIRT786536	hsa-miR-584	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786540	hsa-miR-655	CLIP-seq
MIRT1931970	hsa-miR-1	CLIP-seq
MIRT1931971	hsa-miR-1287	CLIP-seq
MIRT1931972	hsa-miR-206	CLIP-seq
MIRT1931973	hsa-miR-208a	CLIP-seq
MIRT1931974	hsa-miR-208b	CLIP-seq
MIRT1931975	hsa-miR-320e	CLIP-seq
MIRT1931976	hsa-miR-3617	CLIP-seq
MIRT1931977	hsa-miR-3673	CLIP-seq
MIRT1931978	hsa-miR-3688-3p	CLIP-seq
MIRT786521	hsa-miR-369-3p	CLIP-seq
MIRT1931979	hsa-miR-374a	CLIP-seq
MIRT1931980	hsa-miR-374b	CLIP-seq
MIRT1931981	hsa-miR-4291	CLIP-seq
MIRT1931982	hsa-miR-4307	CLIP-seq
MIRT1931983	hsa-miR-4310	CLIP-seq
MIRT1931984	hsa-miR-4517	CLIP-seq
MIRT1931985	hsa-miR-4729	CLIP-seq
MIRT1931986	hsa-miR-499-5p	CLIP-seq
MIRT1931987	hsa-miR-613	CLIP-seq
MIRT1931988	hsa-miR-641	CLIP-seq
MIRT2172417	hsa-miR-124	CLIP-seq
MIRT2172418	hsa-miR-128	CLIP-seq
MIRT2172419	hsa-miR-132	CLIP-seq
MIRT2172420	hsa-miR-148a	CLIP-seq
MIRT2172421	hsa-miR-148b	CLIP-seq
MIRT2172422	hsa-miR-152	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT2172423	hsa-miR-212	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT1931985	hsa-miR-4729	CLIP-seq
MIRT2172424	hsa-miR-4773	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT2172425	hsa-miR-488	CLIP-seq
MIRT2172426	hsa-miR-506	CLIP-seq
MIRT2172427	hsa-miR-548an	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT2475350	hsa-miR-3662	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT2475351	hsa-miR-3973	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT2475352	hsa-miR-4251	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT2475353	hsa-miR-4274	CLIP-seq
MIRT2475354	hsa-miR-4280	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT2475355	hsa-miR-4329	CLIP-seq
MIRT2475356	hsa-miR-4519	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT2475357	hsa-miR-4670-3p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT2475358	hsa-miR-520g	CLIP-seq
MIRT2475359	hsa-miR-520h	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq
MIRT786506	hsa-miR-105	CLIP-seq
MIRT786507	hsa-miR-1179	CLIP-seq
MIRT786510	hsa-miR-1827	CLIP-seq
MIRT786511	hsa-miR-3148	CLIP-seq
MIRT786513	hsa-miR-3162-5p	CLIP-seq
MIRT786515	hsa-miR-3185	CLIP-seq
MIRT786516	hsa-miR-3186-5p	CLIP-seq
MIRT786517	hsa-miR-3609	CLIP-seq
MIRT786518	hsa-miR-3612	CLIP-seq
MIRT786519	hsa-miR-3646	CLIP-seq
MIRT2475350	hsa-miR-3662	CLIP-seq
MIRT786520	hsa-miR-3671	CLIP-seq
MIRT2475351	hsa-miR-3973	CLIP-seq
MIRT786523	hsa-miR-3978	CLIP-seq
MIRT2475352	hsa-miR-4251	CLIP-seq
MIRT786525	hsa-miR-4266	CLIP-seq
MIRT2475353	hsa-miR-4274	CLIP-seq
MIRT2475354	hsa-miR-4280	CLIP-seq
MIRT786526	hsa-miR-4303	CLIP-seq
MIRT2475355	hsa-miR-4329	CLIP-seq
MIRT2675074	hsa-miR-4421	CLIP-seq
MIRT2475356	hsa-miR-4519	CLIP-seq
MIRT786527	hsa-miR-4661-5p	CLIP-seq
MIRT786528	hsa-miR-4668-5p	CLIP-seq
MIRT2475357	hsa-miR-4670-3p	CLIP-seq
MIRT786529	hsa-miR-4695-5p	CLIP-seq
MIRT786530	hsa-miR-4779	CLIP-seq
MIRT786531	hsa-miR-4796-5p	CLIP-seq
MIRT2475358	hsa-miR-520g	CLIP-seq
MIRT2475359	hsa-miR-520h	CLIP-seq
MIRT786532	hsa-miR-548ah	CLIP-seq
MIRT786533	hsa-miR-548c-3p	CLIP-seq
MIRT786534	hsa-miR-548t	CLIP-seq
MIRT2675075	hsa-miR-580	CLIP-seq
MIRT786537	hsa-miR-606	CLIP-seq
MIRT786538	hsa-miR-607	CLIP-seq
MIRT786539	hsa-miR-650	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20237821
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0004859	Function	Phospholipase inhibitor activity	NAS	2970257
GO:0005509	Function	Calcium ion binding	IDA	20237821
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 32296183, 32814053
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005544	Function	Calcium-dependent phospholipid binding	NAS	2970257
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16687573, 20237821
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20237821
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16687573
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0007219	Process	Notch signaling pathway	IEA
GO:0009986	Component	Cell surface	IDA	22056994
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	20237821
GO:0012506	Component	Vesicle membrane	IBA
GO:0012506	Component	Vesicle membrane	IDA	16687573
GO:0016020	Component	Membrane	IEA
GO:0030855	Process	Epithelial cell differentiation	IEP	21492153
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28675934
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031965	Component	Nuclear membrane	IDA	16687573
GO:0032717	Process	Negative regulation of interleukin-8 production	IMP	22056994
GO:0042589	Component	Zymogen granule membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	16687573
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	20237821
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301, 20237821
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16687573
GO:0051059	Function	NF-kappaB binding	IPI	20237821
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	20237821

MIM	HGNC	e!Ensembl
106491	542	ENSG00000196975

P09525

Protein name

Annexin A4 (35-beta calcimedin) (Annexin IV) (Annexin-4) (Carbohydrate-binding protein p33/p41) (Chromobindin-4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4-X) (Placental anticoagulant protein II) (PAP-II) (Protein II)

Protein function

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

PDB

2ZOC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00191	Annexin	18 → 83	Annexin	Family
PF00191	Annexin	90 → 155	Annexin	Family
PF00191	Annexin	173 → 239	Annexin	Family
PF00191	Annexin	249 → 314	Annexin	Family

Sequence

MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTI
GRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEE
IRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYE
AGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIV
KCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
GDTSGDYRKVLLVLCGGDD

Sequence length

319

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (79)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	9094435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	9094435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	19598262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37925455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15642131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22847161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	28416818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	37581400	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	27100483, 29709904, 30104400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22970268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26779633	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24223161, 27166255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22321069, 37464398	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33828127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27485544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21348943, 25633807, 27100483, 29296226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18839982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28943450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28943450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	21348943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16893879, 21209152, 22799385, 25206290, 26495974, 28986585, 33761465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15108329, 20437403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28865912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	Pubtator	39350328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22415234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21348943, 25633807, 29296226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24833881	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	35862065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35862065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	24244679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22759382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	37277809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26779633, 28670491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	33846781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	29709904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27100483, 29709904, 30104400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24223161, 27166255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22970268, 30837034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22970268, 27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28865912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22497892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29627895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29296226		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21348943, 22321069, 24244679, 31474227, 33125094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	27100483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15108329, 20437403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15145526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28261963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	26495974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31366407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22970268, 30837034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	22970268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22970268	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30837034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27402115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANXA4 (annexin A4)