HDAC2 (histone deacetylase 2)

Gene

• Entrez ID: 3066
• Gene name: Histone deacetylase 2
• Gene symbol: HDAC2
• Synonyms (NCBI Gene): HD2, KDAC2, RPD3, YAF1
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007307	hsa-miR-145-5p	Luciferase reporter assay	23499894
MIRT023724	hsa-miR-1-3p	Proteomics	18668040
MIRT045549	hsa-miR-149-5p	CLASH	23622248
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT437990	hsa-let-7f-5p	qRT-PCR	24405266
MIRT733684	hsa-miR-494-3p	Flow cytometry, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	31465536
MIRT736874	hsa-miR-204-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	33614251
MIRT1042307	hsa-let-7a	CLIP-seq
MIRT1042308	hsa-let-7b	CLIP-seq
MIRT1042309	hsa-let-7c	CLIP-seq
MIRT1042310	hsa-let-7d	CLIP-seq
MIRT1042311	hsa-let-7e	CLIP-seq
MIRT1042312	hsa-let-7f	CLIP-seq
MIRT1042313	hsa-let-7g	CLIP-seq
MIRT1042314	hsa-let-7i	CLIP-seq
MIRT1042315	hsa-miR-103a	CLIP-seq
MIRT1042316	hsa-miR-107	CLIP-seq
MIRT1042317	hsa-miR-1205	CLIP-seq
MIRT1042318	hsa-miR-1226	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042320	hsa-miR-1254	CLIP-seq
MIRT1042321	hsa-miR-1262	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042325	hsa-miR-1295	CLIP-seq
MIRT1042326	hsa-miR-1304	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT1042329	hsa-miR-186	CLIP-seq
MIRT1042330	hsa-miR-188-3p	CLIP-seq
MIRT1042331	hsa-miR-197	CLIP-seq
MIRT1042332	hsa-miR-202	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042334	hsa-miR-2467-3p	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042336	hsa-miR-3116	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042338	hsa-miR-3124-3p	CLIP-seq
MIRT1042339	hsa-miR-3133	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042342	hsa-miR-3153	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042344	hsa-miR-3173-3p	CLIP-seq
MIRT1042345	hsa-miR-3177-5p	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042349	hsa-miR-338-5p	CLIP-seq
MIRT1042350	hsa-miR-3605-5p	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT1042353	hsa-miR-362-5p	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT1042355	hsa-miR-3656	CLIP-seq
MIRT1042356	hsa-miR-3668	CLIP-seq
MIRT1042357	hsa-miR-3671	CLIP-seq
MIRT1042358	hsa-miR-3682-5p	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042361	hsa-miR-3690	CLIP-seq
MIRT1042362	hsa-miR-3691-3p	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT1042367	hsa-miR-3915	CLIP-seq
MIRT1042368	hsa-miR-3924	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT1042370	hsa-miR-3928	CLIP-seq
MIRT1042371	hsa-miR-3937	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT1042373	hsa-miR-4269	CLIP-seq
MIRT1042374	hsa-miR-4275	CLIP-seq
MIRT1042375	hsa-miR-4282	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042377	hsa-miR-4328	CLIP-seq
MIRT1042378	hsa-miR-4428	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042380	hsa-miR-4458	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042382	hsa-miR-4476	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042386	hsa-miR-4500	CLIP-seq
MIRT1042387	hsa-miR-4511	CLIP-seq
MIRT1042388	hsa-miR-451b	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042390	hsa-miR-4638-3p	CLIP-seq
MIRT1042391	hsa-miR-4646-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT1042393	hsa-miR-4668-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042395	hsa-miR-4699-3p	CLIP-seq
MIRT1042396	hsa-miR-4701-3p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042400	hsa-miR-4744	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042402	hsa-miR-4755-3p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042408	hsa-miR-495	CLIP-seq
MIRT1042409	hsa-miR-500b	CLIP-seq
MIRT1042410	hsa-miR-501-5p	CLIP-seq
MIRT1042411	hsa-miR-502-5p	CLIP-seq
MIRT1042412	hsa-miR-511	CLIP-seq
MIRT1042413	hsa-miR-520d-5p	CLIP-seq
MIRT1042414	hsa-miR-524-5p	CLIP-seq
MIRT1042415	hsa-miR-526b	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT1042417	hsa-miR-548b-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT1042421	hsa-miR-548k	CLIP-seq
MIRT1042422	hsa-miR-548n	CLIP-seq
MIRT1042423	hsa-miR-548p	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT1042425	hsa-miR-556-3p	CLIP-seq
MIRT1042426	hsa-miR-558	CLIP-seq
MIRT1042427	hsa-miR-579	CLIP-seq
MIRT1042428	hsa-miR-587	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042430	hsa-miR-607	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT1042432	hsa-miR-633	CLIP-seq
MIRT1042433	hsa-miR-661	CLIP-seq
MIRT1042434	hsa-miR-98	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042307	hsa-let-7a	CLIP-seq
MIRT1042308	hsa-let-7b	CLIP-seq
MIRT1042309	hsa-let-7c	CLIP-seq
MIRT1042310	hsa-let-7d	CLIP-seq
MIRT1042311	hsa-let-7e	CLIP-seq
MIRT1042312	hsa-let-7f	CLIP-seq
MIRT1042313	hsa-let-7g	CLIP-seq
MIRT1042314	hsa-let-7i	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042320	hsa-miR-1254	CLIP-seq
MIRT1042321	hsa-miR-1262	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042326	hsa-miR-1304	CLIP-seq
MIRT2008921	hsa-miR-135a	CLIP-seq
MIRT2008922	hsa-miR-135b	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT1042332	hsa-miR-202	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2008925	hsa-miR-2114	CLIP-seq
MIRT2008926	hsa-miR-223	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042336	hsa-miR-3116	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042344	hsa-miR-3173-3p	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT2008927	hsa-miR-3194-3p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2008928	hsa-miR-325	CLIP-seq
MIRT2008929	hsa-miR-3607-3p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2008930	hsa-miR-3663-5p	CLIP-seq
MIRT2008931	hsa-miR-3686	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042361	hsa-miR-3690	CLIP-seq
MIRT2008932	hsa-miR-374c	CLIP-seq
MIRT2008933	hsa-miR-377	CLIP-seq
MIRT2008934	hsa-miR-3923	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042377	hsa-miR-4328	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT1042378	hsa-miR-4428	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042380	hsa-miR-4458	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042386	hsa-miR-4500	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042390	hsa-miR-4638-3p	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2008939	hsa-miR-4659a-3p	CLIP-seq
MIRT2008940	hsa-miR-4659b-3p	CLIP-seq
MIRT2008941	hsa-miR-4666-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042396	hsa-miR-4701-3p	CLIP-seq
MIRT2008942	hsa-miR-4704-5p	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2008944	hsa-miR-4778-3p	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042412	hsa-miR-511	CLIP-seq
MIRT1042415	hsa-miR-526b	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2008947	hsa-miR-578	CLIP-seq
MIRT1042427	hsa-miR-579	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2008948	hsa-miR-616	CLIP-seq
MIRT2008949	hsa-miR-655	CLIP-seq
MIRT2008950	hsa-miR-890	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042434	hsa-miR-98	CLIP-seq
MIRT2241267	hsa-miR-1206	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT2241268	hsa-miR-1321	CLIP-seq
MIRT2241269	hsa-miR-15a	CLIP-seq
MIRT2241270	hsa-miR-15b	CLIP-seq
MIRT2241271	hsa-miR-16	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT1042329	hsa-miR-186	CLIP-seq
MIRT2241272	hsa-miR-195	CLIP-seq
MIRT1042331	hsa-miR-197	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2008925	hsa-miR-2114	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042339	hsa-miR-3133	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2241273	hsa-miR-323-5p	CLIP-seq
MIRT2241274	hsa-miR-342-3p	CLIP-seq
MIRT2241275	hsa-miR-3529	CLIP-seq
MIRT1042350	hsa-miR-3605-5p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241276	hsa-miR-3622b-5p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT2241279	hsa-miR-3664-3p	CLIP-seq
MIRT2241280	hsa-miR-3672	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT2241281	hsa-miR-379	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT1042369	hsa-miR-3926	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT2241282	hsa-miR-3934	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT2241284	hsa-miR-424	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2241285	hsa-miR-4270	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2241287	hsa-miR-4441	CLIP-seq
MIRT2241288	hsa-miR-4451	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2241289	hsa-miR-4477a	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT2241290	hsa-miR-4488	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042387	hsa-miR-4511	CLIP-seq
MIRT2241291	hsa-miR-4524	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2241292	hsa-miR-4537	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2241293	hsa-miR-4649-5p	CLIP-seq
MIRT2241294	hsa-miR-4650-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT2241296	hsa-miR-4695-5p	CLIP-seq
MIRT2241297	hsa-miR-4697-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT2241298	hsa-miR-4718	CLIP-seq
MIRT1042398	hsa-miR-4719	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT2241299	hsa-miR-4739	CLIP-seq
MIRT1042400	hsa-miR-4744	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT2241300	hsa-miR-4756-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT2241301	hsa-miR-4766-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT2241302	hsa-miR-486-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT2241303	hsa-miR-497	CLIP-seq
MIRT2241304	hsa-miR-500a	CLIP-seq
MIRT2241305	hsa-miR-503	CLIP-seq
MIRT2241306	hsa-miR-510	CLIP-seq
MIRT2241307	hsa-miR-512-5p	CLIP-seq
MIRT1042413	hsa-miR-520d-5p	CLIP-seq
MIRT1042414	hsa-miR-524-5p	CLIP-seq
MIRT2241308	hsa-miR-541	CLIP-seq
MIRT1042424	hsa-miR-548s	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241310	hsa-miR-646	CLIP-seq
MIRT2241311	hsa-miR-654-5p	CLIP-seq
MIRT2241312	hsa-miR-758	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq
MIRT2241314	hsa-miR-876-3p	CLIP-seq
MIRT2008950	hsa-miR-890	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT1042333	hsa-miR-24	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042347	hsa-miR-3194-5p	CLIP-seq
MIRT1042376	hsa-miR-4284	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2388925	hsa-miR-4651	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2388926	hsa-miR-608	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT1042433	hsa-miR-661	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT2451037	hsa-miR-192	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT2451038	hsa-miR-215	CLIP-seq
MIRT2451039	hsa-miR-28-3p	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT2451040	hsa-miR-3591-3p	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT2451041	hsa-miR-4305	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT2451042	hsa-miR-4731-3p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2451043	hsa-miR-4801	CLIP-seq
MIRT1042417	hsa-miR-548b-3p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT2451039	hsa-miR-28-3p	CLIP-seq
MIRT2465436	hsa-miR-3659	CLIP-seq
MIRT2465437	hsa-miR-3921	CLIP-seq
MIRT2465438	hsa-miR-4653-5p	CLIP-seq
MIRT2465439	hsa-miR-4658	CLIP-seq
MIRT2465440	hsa-miR-4682	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT2465441	hsa-miR-574-5p	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT2008923	hsa-miR-1827	CLIP-seq
MIRT2008924	hsa-miR-2054	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042337	hsa-miR-3122	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT2545012	hsa-miR-3163	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT2241279	hsa-miR-3664-3p	CLIP-seq
MIRT2241280	hsa-miR-3672	CLIP-seq
MIRT1042359	hsa-miR-3689a-3p	CLIP-seq
MIRT1042360	hsa-miR-3689c	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT1042366	hsa-miR-3913-5p	CLIP-seq
MIRT2008935	hsa-miR-3929	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2008936	hsa-miR-4419b	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2545013	hsa-miR-4434	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT2008937	hsa-miR-4478	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT2545014	hsa-miR-4516	CLIP-seq
MIRT2545015	hsa-miR-4531	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2008938	hsa-miR-4649-3p	CLIP-seq
MIRT2545016	hsa-miR-4662a-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT2241296	hsa-miR-4695-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT2008943	hsa-miR-4722-5p	CLIP-seq
MIRT1042399	hsa-miR-4728-5p	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2545017	hsa-miR-4786-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT2008946	hsa-miR-485-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT2241306	hsa-miR-510	CLIP-seq
MIRT2241307	hsa-miR-512-5p	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT2545018	hsa-miR-548ad	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2545019	hsa-miR-566	CLIP-seq
MIRT2545020	hsa-miR-570	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq
MIRT2008951	hsa-miR-940	CLIP-seq
MIRT1042319	hsa-miR-1228	CLIP-seq
MIRT1042322	hsa-miR-1264	CLIP-seq
MIRT1042323	hsa-miR-1285	CLIP-seq
MIRT1042324	hsa-miR-1293	CLIP-seq
MIRT1042327	hsa-miR-146a	CLIP-seq
MIRT1042328	hsa-miR-146b-5p	CLIP-seq
MIRT1042335	hsa-miR-300	CLIP-seq
MIRT1042340	hsa-miR-3135	CLIP-seq
MIRT1042341	hsa-miR-3145-5p	CLIP-seq
MIRT2545012	hsa-miR-3163	CLIP-seq
MIRT1042343	hsa-miR-3165	CLIP-seq
MIRT1042346	hsa-miR-3187-5p	CLIP-seq
MIRT1042348	hsa-miR-3202	CLIP-seq
MIRT1042351	hsa-miR-3606	CLIP-seq
MIRT1042352	hsa-miR-3613-3p	CLIP-seq
MIRT2241277	hsa-miR-3646	CLIP-seq
MIRT1042354	hsa-miR-3647-3p	CLIP-seq
MIRT2241278	hsa-miR-3662	CLIP-seq
MIRT1042363	hsa-miR-371-5p	CLIP-seq
MIRT1042364	hsa-miR-371b-5p	CLIP-seq
MIRT1042365	hsa-miR-381	CLIP-seq
MIRT2241282	hsa-miR-3934	CLIP-seq
MIRT2241283	hsa-miR-3973	CLIP-seq
MIRT1042372	hsa-miR-4252	CLIP-seq
MIRT2241286	hsa-miR-4422	CLIP-seq
MIRT1042379	hsa-miR-4433	CLIP-seq
MIRT2545013	hsa-miR-4434	CLIP-seq
MIRT1042381	hsa-miR-4459	CLIP-seq
MIRT1042383	hsa-miR-4480	CLIP-seq
MIRT1042384	hsa-miR-4483	CLIP-seq
MIRT1042385	hsa-miR-4493	CLIP-seq
MIRT2545014	hsa-miR-4516	CLIP-seq
MIRT2545015	hsa-miR-4531	CLIP-seq
MIRT1042389	hsa-miR-4533	CLIP-seq
MIRT2545016	hsa-miR-4662a-5p	CLIP-seq
MIRT1042392	hsa-miR-4666-3p	CLIP-seq
MIRT2241295	hsa-miR-4676-5p	CLIP-seq
MIRT1042394	hsa-miR-4684-5p	CLIP-seq
MIRT1042397	hsa-miR-4710	CLIP-seq
MIRT1042401	hsa-miR-4753-5p	CLIP-seq
MIRT1042403	hsa-miR-4761-5p	CLIP-seq
MIRT1042404	hsa-miR-4768-3p	CLIP-seq
MIRT2545017	hsa-miR-4786-3p	CLIP-seq
MIRT1042405	hsa-miR-4792	CLIP-seq
MIRT1042406	hsa-miR-4793-3p	CLIP-seq
MIRT2008945	hsa-miR-4797-5p	CLIP-seq
MIRT1042407	hsa-miR-490-3p	CLIP-seq
MIRT1042416	hsa-miR-548a-3p	CLIP-seq
MIRT2545018	hsa-miR-548ad	CLIP-seq
MIRT1042418	hsa-miR-548c-3p	CLIP-seq
MIRT1042419	hsa-miR-548e	CLIP-seq
MIRT1042420	hsa-miR-548f	CLIP-seq
MIRT2241309	hsa-miR-575	CLIP-seq
MIRT1042429	hsa-miR-589	CLIP-seq
MIRT1042431	hsa-miR-612	CLIP-seq
MIRT2241313	hsa-miR-759	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	20697349
MYCN	Activation	20697349
RFX5	Unknown	16464847
YY1	Unknown	11532945

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	9651585
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19041327, 19276356
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000785	Component	Chromatin	HDA	16217013
GO:0000785	Component	Chromatin	IEA
GO:0001221	Function	Transcription coregulator binding	IPI	19041327
GO:0001975	Process	Response to amphetamine	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IDA	16642021, 28497810
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	ISS
GO:0005515	Function	Protein binding	IPI	9150135, 11062478, 11259576, 11641274, 11739383, 12140263, 12176973, 12670868, 12711603, 14752048, 16254079, 16464847, 16919237, 17245431, 17314511, 17318229, 17827154, 17956988, 17984088, 18451879, 19182791, 19343227, 19433865, 19497860, 19505873, 19703393, 19729656, 19805145, 2019
GO:0005634	Component	Nucleus	IDA	18347167, 20523938, 24970816, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24970816
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	12711221
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006338	Process	Chromatin remodeling	IC	17827154
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18347167
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009913	Process	Epidermal cell differentiation	ISS	21093383
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IMP	19276356
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS	18754010
GO:0016358	Process	Dendrite development	ISS
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	17827154, 19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0019213	Function	Deacetylase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	11062478, 11641274
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0031000	Process	Response to caffeine	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0031507	Process	Heterochromatin formation	IBA
GO:0031507	Process	Heterochromatin formation	IEA
GO:0031507	Process	Heterochromatin formation	IMP	19372552
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0032991	Component	Protein-containing complex	IDA	28046085
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IMP	18316616
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	19041327
GO:0033558	Function	Protein lysine deacetylase activity	TAS
GO:0034605	Process	Cellular response to heat	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035098	Component	ESC/E(Z) complex	IDA	20075857
GO:0036211	Process	Protein modification process	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042393	Function	Histone binding	IDA	19276356
GO:0042475	Process	Odontogenesis of dentin-containing tooth	ISS	21093383
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042733	Process	Embryonic digit morphogenesis	ISS	21093383
GO:0042826	Function	Histone deacetylase binding	IPI	28046085
GO:0043066	Process	Negative regulation of apoptotic process	ISS	21093383
GO:0045862	Process	Positive regulation of proteolysis	IMP	19041327
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19041327, 19372552
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0050847	Process	Progesterone receptor signaling pathway	IMP	18316616
GO:0051059	Function	NF-kappaB binding	IEA
GO:0051059	Function	NF-kappaB binding	IPI	17785205
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060789	Process	Hair follicle placode formation	ISS	21093383
GO:0061000	Process	Negative regulation of dendritic spine development	IEA
GO:0061029	Process	Eyelid development in camera-type eye	ISS	21093383
GO:0061198	Process	Fungiform papilla formation	ISS	21093383
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	17827154, 22926524
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070822	Component	Sin3-type complex	IDA	14966270, 17827154
GO:0070822	Component	Sin3-type complex	IEA
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:0160008	Function	Protein decrotonylase activity	IEA
GO:0160009	Function	Histone decrotonylase activity	IDA	28497810
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IDA	29192674
GO:0160010	Function	Protein de-2-hydroxyisobutyrylase activity	IEA
GO:0160216	Function	Protein lysine delactylase activity	IDA	35044827
GO:0160216	Function	Protein lysine delactylase activity	IEA
GO:1902437	Process	Positive regulation of male mating behavior	IEA
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1903351	Process	Cellular response to dopamine	IEA
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

Other IDs

• MIM: 605164
• HGNC: 4853
• e!Ensembl: ENSG00000196591

Protein

• UniProt ID: Q92769
• Protein name: Histone deacetylase 2 (HD2) (EC 3.5.1.98) (Protein deacylase HDAC2) (EC 3.5.1.-)
• Protein function: Histone deacetylase that catalyzes the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed:28497810). Histone deacetylation gives a tag for epigenetic repression and plays an important role
• PDB: 3MAX, 4LXZ, 4LY1, 5IWG, 5IX0, 6G3O, 6WBW, 6WBZ, 6WHN, 6WHO, 6WHQ, 6WHZ, 6WI3, 6XDM, 6XEB, 6XEC, 7JS8, 7KBG, 7KBH, 7LTG, 7LTK, 7LTL, 7MOS, 7MOT, 7MOX, 7MOY, 7MOZ, 7ZZO, 7ZZP, 7ZZR, 7ZZS, 7ZZT, 7ZZU, 7ZZW, 8A0B, 8BPA, 8BPB, 8BPC, 8C60, 9DTQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00850	Hist_deacetyl	29 → 320	Histone deacetylase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed; lower levels in brain and lung.
• Sequence:

  MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
  TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
  GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
  GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
  IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
  GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
  EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
  FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
  KSEQLSNP

• Sequence length: 488

Pathways

KEGG:

ATP-dependent chromatin remodeling
Polycomb repressive complex
Cell cycle
Longevity regulating pathway - multiple species
Notch signaling pathway
TGF-beta signaling pathway
Neutrophil extracellular trap formation
Thyroid hormone signaling pathway
Huntington disease
Amphetamine addiction
Alcoholism
Human papillomavirus infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Chronic myeloid leukemia

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
HDACs deacetylate histones
Notch-HLH transcription pathway
SUMOylation of chromatin organization proteins
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
Regulation of MECP2 expression and activity
EGR2 and SOX10-mediated initiation of Schwann cell myelination
Factors involved in megakaryocyte development and platelet production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HDAC2-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	17043312, 20346000		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12224004		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29344347		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24265759		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25275504		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15144953, 19010907, 20346000, 25873367		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15144953		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25219501	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30483749		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20467334		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	27982123, 37328865	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28600475		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31465536		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	31849603		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	31423206		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19528037, 20398369		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28174112, 30647450		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28174112, 30647450		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18234319, 19812111, 20188830, 20538962, 22156779, 23360759, 24307847, 26617781, 28960099, 30964965, 31391381		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20538962, 24030221, 33510050, 37312162	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31391381	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21143702	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	37345209	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	40033384	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35877665	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30463877	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27886239		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27959513	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	39600279	Inhibit	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26729194, 31843555		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22206711		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37598220	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21959976, 27432453, 28560068, 28785170, 30071870		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12176973, 12527756, 19383825, 23627572, 24376786, 24488910, 25139823, 32110804, 32686908, 33617509, 37749212	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22206711, 24595367		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25473896, 28203711, 35260183	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16642021, 18264134, 21290163		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21206745, 24616922, 26352599, 28434945, 31636472, 34319031, 35764883	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27342975	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26729194, 31843555		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22492270, 25605253, 25970771, 30868056, 31305128		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18714364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20398369, 28028031	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27356570	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24200999		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	25388210	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	26499333		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	19332114	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25013374	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31009642		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29072686		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25972164, 28592694, 28982677, 29218547, 31512115		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24965412		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24965412		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23948281		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23893747	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28260932		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	15337792, 18421014		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16380507, 16436275, 18220485, 21320471, 22005302, 22842217, 23275209, 23360759, 24368768, 26044852, 26617781, 26864305, 28526090, 28915625, 29456664, 29630406, 29782855, 30741829, 31809610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	BEFREE	31281447, 31849603		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30375383		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15144953, 18314102, 18834886, 19881542, 24218540, 25704882		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15144953		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19057998, 36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24218540		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18264134, 19010907, 21290163, 25307864, 26846508, 27283986, 28538837, 30737378, 31524278		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18347167		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19057998, 19881542, 21290163, 23708667, 24948597, 28538837, 33267897	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	27705912		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29141538		★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	30806031		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30110565		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27884646, 30063117		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28202389		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	37328865	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27959513, 30851364		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	27959513	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27959513	Stimulate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35468861	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19553350, 30217947		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19553350, 30217947		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30217947	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34233433	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37066707	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25076845		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	37373058	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19787250		★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	16985053		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	22344732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	22344732	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	21987499		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	21987499		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30363984	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27967209		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	27432453		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27396813		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	27396813		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23242568	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30654849, 32328646, 35260183, 35417530	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27832326		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18708058		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18708058, 21143702, 32328646, 37528157	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30654849	Stimulate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30806031		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	16380507, 21828034, 24368768, 26617781, 34091451, 39526770	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	19482216, 28578424, 31809610		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	30728075	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23193417	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	26116233		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	34091451, 39526770	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28511026		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29141538		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36293392	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27886239		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	27635950		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	27635950	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	16642021, 18264134		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29481474	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18762557		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	24933366	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	34639171	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27673327		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21576649		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	21576649		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35840042, 37543278	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31545224		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31545224	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28352664, 28656275, 30252960, 31796106, 31849603		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30262728		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24218540		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31465536, 31493239		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	31423206		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29072686		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30776024		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35974388	Associate	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	26839444	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	31761932	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	36497061	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28192098, 28235656		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22096027, 25473896, 26858310, 28030834, 28203711, 31254352	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Monocytic, Chronic	Monocytic Leukemia	CTD_human_DG	21535412		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22096027, 25473896, 26858310, 28060870, 28203711, 31254352		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21332579		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	31620242		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22132221, 23499894, 24616922, 24958469, 26676829, 27342975, 28262837, 28411180, 28434945, 30465789, 30582981, 31092334, 31635225, 31636472		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	27396813		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	29725271, 31032867, 31183000		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19812111		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31545224	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31545224		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	23275209		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23110995, 25605253, 25970771, 27356570, 30868056, 34203519	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24441677	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23242568	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32865179	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25076845		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25076845	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	18671804		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27959513		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29482000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21959976, 27432453, 28560068, 28785170, 30071870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19787250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22132221, 23499894, 24616922, 24958469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22492270, 25605253, 25970771, 30868056, 31305128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21332579		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24200999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19362090, 19528037, 20398369, 22147512, 27721407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27641328, 30453545, 30720161, 31843555		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23175521, 30250993, 30266498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28600475, 30669676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26729194, 31843555		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15144953, 15665816, 18264134, 22800507, 24905164, 27832326		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24965412		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15144953, 18314102, 18834886, 19881542, 24218540, 25704882		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29326587		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25853389	Stimulate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	32822486	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	35055045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	19767015, 27959513, 30851364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19767015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	25970771		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25970771, 26254420	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29654189		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	19767015, 23967191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	32865179	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20351311		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25482492	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21535412		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	CTD_human_DG	21535412		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21685935, 26603102		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26934447, 37082996	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15144953, 16642021, 17718852, 18264134, 18834886, 21527555, 22132221, 22465428, 22492270, 23873102, 25275504, 25704882, 26676829, 26729194, 27130196, 27283986, 28125812, 28600475, 29158005, 29333444, 29482000, 29590609, 30071870, 30509303, 30737378, 31620242, 31805977		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29098400		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28364391, 29170627		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15382088, 20697349, 23625969, 23706636		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23706636, 36130928, 37488358, 38063204	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33802405	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28202389, 28326018, 28796285		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	26603102		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27665474, 28223039, 28839465, 31713888		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	22864611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	29142617		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29142617	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29326587		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27884646, 30063117	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28984297, 30868056, 31337976	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30509303, 30706385, 30868056		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24200999		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19362090, 19528037, 20398369, 22147512, 27721407		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19528037, 28028031		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20398369, 26502922	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25275504	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29257262		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29803514		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	22512277		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31423206		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	23770939, 24841412, 29706035		★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	27967209		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28202389		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	30766871		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27641328, 30453545, 30720161, 31843555		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18212746		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18212746, 22531786, 30453545, 30720161, 34034634, 37543278	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	22864611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15888697, 16380507, 18421014, 24368768, 26498345, 33510050, 37373058	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23717666, 26809128, 28526090, 37180749	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21318260, 24040961, 29630406		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28961490		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31843983		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	16086395		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	23764045	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35480562	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22037263, 26254420	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22864611, 23857786, 26063464, 27959513, 30025863, 30530989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22864611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27959513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30530989	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	28628607	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30207412		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	22344732	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	22344732		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	26636516	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	15772088		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21332579, 21527555		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	21527555		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28123574, 30363984, 31120582		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27349552	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32865179	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	28107582		★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	31191307		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23175521, 30250993, 30266498		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24668547, 34232196	Stimulate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28202389		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28600475, 30669676		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	23873102	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28600475, 30669676		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30669676	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29896413		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29896413		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	27959513		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25921176, 26729194	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26772204, 27250763		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22029821	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24606473, 24965412	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35332245	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	36293392	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30217947	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	27899394		★☆☆☆☆ Found in Text Mining only