Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3062
Gene name	Hypocretin receptor 2
Gene symbol	HCRTR2
Synonyms (NCBI Gene)	ORXR2OX2ROXR2
Chromosome	6
Chromosome location	6p12.1
Summary	The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor t

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26950369
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9491897
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	26950369
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9491897
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	9491897
GO:0007631	Process	Feeding behavior	IEA
GO:0007631	Process	Feeding behavior	TAS	9491897
GO:0008188	Function	Neuropeptide receptor activity	TAS	9491897
GO:0010840	Process	Regulation of circadian sleep/wake cycle, wakefulness	ISS
GO:0016020	Component	Membrane	IEA
GO:0016499	Function	Orexin receptor activity	IBA
GO:0016499	Function	Orexin receptor activity	IDA	26950369
GO:0016499	Function	Orexin receptor activity	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0022410	Process	Circadian sleep/wake cycle process	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0040011	Process	Locomotion	IEA
GO:0045202	Component	Synapse	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	26950369
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA

MIM	HGNC	e!Ensembl
602393	4849	ENSG00000137252

O43614

Protein name

Orexin receptor type 2 (Ox-2-R) (Ox2-R) (Ox2R) (Hypocretin receptor type 2)

Protein function

Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides (PubMed:26950369, PubMed:9491897). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:26950369, PubMed:9491897). {ECO:000026

PDB

4S0V , 5WQC , 5WS3 , 6TPG , 6TPJ , 6TPN , 7L1U , 7L1V , 7SQO , 7SR8 , 7XRR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	71 → 364	7 transmembrane receptor (rhodopsin family)	Family
PF03827	Orexin_rec2	387 → 444	Orexin receptor type 2	Family

Sequence

MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW

Sequence length

444

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Orexin and neuropeptides FF and QRFP bind to their respective receptors G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HCRTR2-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

HCRTR2 (hypocretin receptor 2)