Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3038
Gene name	Hyaluronan synthase 3
Gene symbol	HAS3
Synonyms (NCBI Gene)	-
Chromosome	16
Chromosome location	16q22.1
Summary	The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2232228	A>C,G	Drug-response	Synonymous variant, coding sequence variant

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024770	hsa-miR-215-5p	Microarray	19074876
MIRT026580	hsa-miR-192-5p	Microarray	19074876
MIRT536973	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT536972	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT536971	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT536970	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT536969	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT536968	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT536967	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT536966	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT242427	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT242426	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT242425	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536965	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536964	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536963	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536962	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536961	hsa-miR-302e	PAR-CLIP	22012620
MIRT536960	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536959	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536958	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536957	hsa-miR-520b	PAR-CLIP	22012620
MIRT536956	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536955	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536954	hsa-miR-520e	PAR-CLIP	22012620
MIRT536953	hsa-miR-3163	PAR-CLIP	22012620
MIRT242424	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT536952	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT536951	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT536973	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT536972	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT536971	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT536970	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT536969	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT536968	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT536967	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT536966	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT242427	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT242426	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT242425	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536965	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536964	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536963	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536962	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536961	hsa-miR-302e	PAR-CLIP	22012620
MIRT536960	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536959	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536958	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536957	hsa-miR-520b	PAR-CLIP	22012620
MIRT536956	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536955	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536954	hsa-miR-520e	PAR-CLIP	22012620
MIRT536953	hsa-miR-3163	PAR-CLIP	22012620
MIRT242424	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT536952	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT536951	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT1040884	hsa-miR-105	CLIP-seq
MIRT1040885	hsa-miR-1225-3p	CLIP-seq
MIRT1040886	hsa-miR-1228	CLIP-seq
MIRT1040887	hsa-miR-1233	CLIP-seq
MIRT1040888	hsa-miR-1238	CLIP-seq
MIRT1040889	hsa-miR-1272	CLIP-seq
MIRT1040890	hsa-miR-1322	CLIP-seq
MIRT1040891	hsa-miR-134	CLIP-seq
MIRT1040892	hsa-miR-136	CLIP-seq
MIRT1040893	hsa-miR-155	CLIP-seq
MIRT1040894	hsa-miR-224	CLIP-seq
MIRT1040895	hsa-miR-2355-3p	CLIP-seq
MIRT1040896	hsa-miR-24	CLIP-seq
MIRT1040897	hsa-miR-3118	CLIP-seq
MIRT1040898	hsa-miR-3121-5p	CLIP-seq
MIRT1040899	hsa-miR-3130-3p	CLIP-seq
MIRT1040900	hsa-miR-3132	CLIP-seq
MIRT1040901	hsa-miR-3167	CLIP-seq
MIRT1040902	hsa-miR-3612	CLIP-seq
MIRT1040903	hsa-miR-3613-3p	CLIP-seq
MIRT1040904	hsa-miR-3614-5p	CLIP-seq
MIRT1040905	hsa-miR-3619-3p	CLIP-seq
MIRT1040906	hsa-miR-3664-3p	CLIP-seq
MIRT1040907	hsa-miR-3682-3p	CLIP-seq
MIRT1040908	hsa-miR-371b-5p	CLIP-seq
MIRT1040909	hsa-miR-377	CLIP-seq
MIRT1040910	hsa-miR-4284	CLIP-seq
MIRT1040911	hsa-miR-4293	CLIP-seq
MIRT1040912	hsa-miR-4325	CLIP-seq
MIRT1040913	hsa-miR-4418	CLIP-seq
MIRT1040914	hsa-miR-4433	CLIP-seq
MIRT1040915	hsa-miR-4459	CLIP-seq
MIRT1040916	hsa-miR-4474-3p	CLIP-seq
MIRT1040917	hsa-miR-4480	CLIP-seq
MIRT1040918	hsa-miR-451b	CLIP-seq
MIRT1040919	hsa-miR-4520b-3p	CLIP-seq
MIRT1040920	hsa-miR-4529-3p	CLIP-seq
MIRT1040921	hsa-miR-4535	CLIP-seq
MIRT1040922	hsa-miR-4539	CLIP-seq
MIRT1040923	hsa-miR-4641	CLIP-seq
MIRT1040924	hsa-miR-4643	CLIP-seq
MIRT1040925	hsa-miR-4646-3p	CLIP-seq
MIRT1040926	hsa-miR-4650-3p	CLIP-seq
MIRT1040927	hsa-miR-4680-5p	CLIP-seq
MIRT1040928	hsa-miR-4691-5p	CLIP-seq
MIRT1040929	hsa-miR-4695-5p	CLIP-seq
MIRT1040930	hsa-miR-4698	CLIP-seq
MIRT1040931	hsa-miR-4712-3p	CLIP-seq
MIRT1040932	hsa-miR-4766-5p	CLIP-seq
MIRT1040933	hsa-miR-4768-3p	CLIP-seq
MIRT1040934	hsa-miR-4776-5p	CLIP-seq
MIRT1040935	hsa-miR-4777-3p	CLIP-seq
MIRT1040936	hsa-miR-4793-3p	CLIP-seq
MIRT1040937	hsa-miR-509-3-5p	CLIP-seq
MIRT1040938	hsa-miR-509-5p	CLIP-seq
MIRT1040939	hsa-miR-548aa	CLIP-seq
MIRT1040940	hsa-miR-548ac	CLIP-seq
MIRT1040941	hsa-miR-548d-3p	CLIP-seq
MIRT1040942	hsa-miR-548z	CLIP-seq
MIRT1040943	hsa-miR-576-5p	CLIP-seq
MIRT1040944	hsa-miR-647	CLIP-seq
MIRT1040945	hsa-miR-650	CLIP-seq
MIRT1040946	hsa-miR-676	CLIP-seq
MIRT1040947	hsa-miR-875-5p	CLIP-seq
MIRT1040948	hsa-miR-876-5p	CLIP-seq
MIRT1040949	hsa-miR-941	CLIP-seq
MIRT1040950	hsa-miR-943	CLIP-seq
MIRT1040884	hsa-miR-105	CLIP-seq
MIRT1040885	hsa-miR-1225-3p	CLIP-seq
MIRT1040887	hsa-miR-1233	CLIP-seq
MIRT1040951	hsa-miR-1252	CLIP-seq
MIRT1040952	hsa-miR-1275	CLIP-seq
MIRT1040953	hsa-miR-1299	CLIP-seq
MIRT1040954	hsa-miR-143	CLIP-seq
MIRT1040955	hsa-miR-216b	CLIP-seq
MIRT1040956	hsa-miR-3128	CLIP-seq
MIRT1040902	hsa-miR-3612	CLIP-seq
MIRT1040957	hsa-miR-3614-3p	CLIP-seq
MIRT1040906	hsa-miR-3664-3p	CLIP-seq
MIRT1040958	hsa-miR-3667-3p	CLIP-seq
MIRT1040959	hsa-miR-3677-3p	CLIP-seq
MIRT1040960	hsa-miR-370	CLIP-seq
MIRT1040961	hsa-miR-375	CLIP-seq
MIRT1040962	hsa-miR-3978	CLIP-seq
MIRT1040963	hsa-miR-4297	CLIP-seq
MIRT1040964	hsa-miR-4301	CLIP-seq
MIRT1040965	hsa-miR-4302	CLIP-seq
MIRT1040966	hsa-miR-4326	CLIP-seq
MIRT1040967	hsa-miR-4423-5p	CLIP-seq
MIRT1040914	hsa-miR-4433	CLIP-seq
MIRT1040915	hsa-miR-4459	CLIP-seq
MIRT1040968	hsa-miR-4470	CLIP-seq
MIRT1040918	hsa-miR-451b	CLIP-seq
MIRT1040969	hsa-miR-4525	CLIP-seq
MIRT1040970	hsa-miR-4665-5p	CLIP-seq
MIRT1040971	hsa-miR-4667-5p	CLIP-seq
MIRT1040972	hsa-miR-4690-5p	CLIP-seq
MIRT1040928	hsa-miR-4691-5p	CLIP-seq
MIRT1040929	hsa-miR-4695-5p	CLIP-seq
MIRT1040973	hsa-miR-4700-5p	CLIP-seq
MIRT1040931	hsa-miR-4712-3p	CLIP-seq
MIRT1040974	hsa-miR-4723-5p	CLIP-seq
MIRT1040975	hsa-miR-4742-5p	CLIP-seq
MIRT1040976	hsa-miR-4753-3p	CLIP-seq
MIRT1040977	hsa-miR-4763-5p	CLIP-seq
MIRT1040933	hsa-miR-4768-3p	CLIP-seq
MIRT1040978	hsa-miR-4770	CLIP-seq
MIRT1040979	hsa-miR-4782-5p	CLIP-seq
MIRT1040980	hsa-miR-486-5p	CLIP-seq
MIRT1040981	hsa-miR-516b	CLIP-seq
MIRT1040939	hsa-miR-548aa	CLIP-seq
MIRT1040940	hsa-miR-548ac	CLIP-seq
MIRT1040941	hsa-miR-548d-3p	CLIP-seq
MIRT1040942	hsa-miR-548z	CLIP-seq
MIRT1040982	hsa-miR-589	CLIP-seq
MIRT1040983	hsa-miR-625	CLIP-seq
MIRT1040984	hsa-miR-637	CLIP-seq
MIRT1040945	hsa-miR-650	CLIP-seq
MIRT1040985	hsa-miR-657	CLIP-seq
MIRT1040986	hsa-miR-659	CLIP-seq
MIRT1040987	hsa-miR-875-3p	CLIP-seq
MIRT1040884	hsa-miR-105	CLIP-seq
MIRT1040891	hsa-miR-134	CLIP-seq
MIRT1040897	hsa-miR-3118	CLIP-seq
MIRT1040950	hsa-miR-943	CLIP-seq
MIRT2388906	hsa-miR-3622b-5p	CLIP-seq
MIRT2388907	hsa-miR-3688-5p	CLIP-seq
MIRT1040916	hsa-miR-4474-3p	CLIP-seq
MIRT2429501	hsa-miR-583	CLIP-seq
MIRT2544569	hsa-miR-1972	CLIP-seq
MIRT2544570	hsa-miR-3124-3p	CLIP-seq
MIRT1040968	hsa-miR-4470	CLIP-seq
MIRT2544571	hsa-miR-4650-5p	CLIP-seq
MIRT2544572	hsa-miR-499-3p	CLIP-seq
MIRT2544573	hsa-miR-499a-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000271	Process	Polysaccharide biosynthetic process	IBA
GO:0000271	Process	Polysaccharide biosynthetic process	IEA
GO:0000271	Process	Polysaccharide biosynthetic process	ISS
GO:0005515	Function	Protein binding	IPI	20507985, 25795779, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	25795779
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25795779, 26883802
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9169154
GO:0005975	Process	Carbohydrate metabolic process	TAS	9169154
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9083017
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IBA
GO:0030213	Process	Hyaluronan biosynthetic process	IDA	16900089
GO:0030213	Process	Hyaluronan biosynthetic process	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	TAS
GO:0036117	Component	Hyaluranon cable	IDA	16900089
GO:0042802	Function	Identical protein binding	IPI	25795779
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16900089
GO:0050501	Function	Hyaluronan synthase activity	IBA
GO:0050501	Function	Hyaluronan synthase activity	IDA	16900089, 23303191
GO:0050501	Function	Hyaluronan synthase activity	IEA
GO:0050501	Function	Hyaluronan synthase activity	TAS
GO:0085029	Process	Extracellular matrix assembly	IBA
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0085029	Process	Extracellular matrix assembly	ISS
GO:1900106	Process	Positive regulation of hyaluranon cable assembly	IDA	16900089

MIM	HGNC	e!Ensembl
602428	4820	ENSG00000103044

O00219

Protein name

Hyaluronan synthase 3 (EC 2.4.1.212) (Hyaluronate synthase 3) (Hyaluronic acid synthase 3) (HA synthase 3)

Protein function

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13641	Glyco_tranf_2_3	154 → 360		Domain

Sequence

MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM
VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA
STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG
VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS
YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG
LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG
KKPEQYSLAFAEV

Sequence length

553

Interactions

View interactions

	Reactome
			Hyaluronan biosynthesis and export

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	11790779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28987865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28987865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37247276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25223521	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25934334	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23202930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26352698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	20875124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	20849445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	24470002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	24470002, 26968791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14566823, 21453239, 22934709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22934709, 23922913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	35028126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	24658508, 31049964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	27833999, 31049964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18587729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27833999, 31049964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	27042213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	10794710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	19886734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21263749, 34521918	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18587729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28107185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30689936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26352698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28107185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11431361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21453239, 22934709		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26222208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31820036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	23560496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	10794710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	15161000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	40481899	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26661071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11431361, 14566823, 15231668, 21315068, 21429221, 21453239, 25934334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31274246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28460475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16773198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23202930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30614308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11431361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	13130151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21429221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36497040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	27042213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29693123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30139970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25223521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	25934334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25934334		★★★★★ ★☆☆☆☆ Found in Text Mining only

HAS3 (hyaluronan synthase 3)