Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3037
Gene name	Hyaluronan synthase 2
Gene symbol	HAS2
Synonyms (NCBI Gene)	-
Chromosome	8
Chromosome location	8q24.13
Summary	Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and

236

Show/Hide all (236)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005828	hsa-miR-204-5p	Microarray	21282569
MIRT035534	hsa-let-7a-5p	Luciferase reporter assay	22871741
MIRT437760	hsa-miR-202-3p	Luciferase reporter assay	23334589
MIRT706426	hsa-miR-106a-5p	HITS-CLIP	22927820
MIRT706425	hsa-miR-106b-5p	HITS-CLIP	22927820
MIRT706424	hsa-miR-17-5p	HITS-CLIP	22927820
MIRT706423	hsa-miR-20a-5p	HITS-CLIP	22927820
MIRT706422	hsa-miR-20b-5p	HITS-CLIP	22927820
MIRT706421	hsa-miR-519d-3p	HITS-CLIP	22927820
MIRT706420	hsa-miR-526b-3p	HITS-CLIP	22927820
MIRT706419	hsa-miR-93-5p	HITS-CLIP	22927820
MIRT706418	hsa-miR-302a-3p	HITS-CLIP	22927820
MIRT706417	hsa-miR-302b-3p	HITS-CLIP	22927820
MIRT706416	hsa-miR-302c-3p	HITS-CLIP	22927820
MIRT706415	hsa-miR-302d-3p	HITS-CLIP	22927820
MIRT706414	hsa-miR-302e	HITS-CLIP	22927820
MIRT706413	hsa-miR-372-3p	HITS-CLIP	22927820
MIRT706412	hsa-miR-373-3p	HITS-CLIP	22927820
MIRT706411	hsa-miR-520a-3p	HITS-CLIP	22927820
MIRT706410	hsa-miR-520b	HITS-CLIP	22927820
MIRT706409	hsa-miR-520c-3p	HITS-CLIP	22927820
MIRT706408	hsa-miR-520d-3p	HITS-CLIP	22927820
MIRT706407	hsa-miR-520e	HITS-CLIP	22927820
MIRT706406	hsa-miR-1245a	HITS-CLIP	22927820
MIRT706405	hsa-miR-8079	HITS-CLIP	22927820
MIRT706404	hsa-miR-512-3p	HITS-CLIP	22927820
MIRT706403	hsa-miR-520g-3p	HITS-CLIP	22927820
MIRT706402	hsa-miR-520h	HITS-CLIP	22927820
MIRT706401	hsa-miR-6513-3p	HITS-CLIP	22927820
MIRT703037	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT703036	hsa-miR-1224-3p	HITS-CLIP	22927820
MIRT703035	hsa-miR-1234-3p	HITS-CLIP	22927820
MIRT703034	hsa-miR-7107-5p	HITS-CLIP	22927820
MIRT703033	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706400	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706399	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706398	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT703032	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706397	hsa-miR-4731-5p	HITS-CLIP	22927820
MIRT706396	hsa-miR-5589-5p	HITS-CLIP	22927820
MIRT706395	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706394	hsa-miR-640	HITS-CLIP	22927820
MIRT703050	hsa-miR-4698	HITS-CLIP	23313552
MIRT703049	hsa-miR-221-5p	HITS-CLIP	23313552
MIRT703048	hsa-miR-8073	HITS-CLIP	23313552
MIRT703047	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT703046	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT703045	hsa-miR-532-3p	HITS-CLIP	23313552
MIRT703043	hsa-miR-3176	HITS-CLIP	23313552
MIRT703044	hsa-miR-3922-3p	HITS-CLIP	23313552
MIRT703042	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT703041	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT703040	hsa-miR-188-3p	HITS-CLIP	23313552
MIRT703039	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT703038	hsa-miR-2114-3p	HITS-CLIP	23313552
MIRT703037	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT703036	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT703035	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT703034	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT703033	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT703032	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT703031	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT703030	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT657516	hsa-miR-488-3p	HITS-CLIP	23824327
MIRT657515	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT657514	hsa-miR-3133	HITS-CLIP	23824327
MIRT657513	hsa-miR-4511	HITS-CLIP	23824327
MIRT657512	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT657511	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT628173	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT628172	hsa-miR-8063	HITS-CLIP	23824327
MIRT628171	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657510	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT628169	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT628173	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT628172	hsa-miR-8063	HITS-CLIP	23824327
MIRT628171	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT628170	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT628169	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT628168	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT628167	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT731558	hsa-miR-26b-5p	Luciferase reporter assay	26887530
MIRT731558	hsa-miR-26b-5p	Luciferase reporter assay	26887530
MIRT735895	hsa-let-7b-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	31736114
MIRT735958	hsa-miR-23a-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunocytochemistry (ICC)	31933920
MIRT706426	hsa-miR-106a-5p	HITS-CLIP	22927820
MIRT706425	hsa-miR-106b-5p	HITS-CLIP	22927820
MIRT706424	hsa-miR-17-5p	HITS-CLIP	22927820
MIRT706423	hsa-miR-20a-5p	HITS-CLIP	22927820
MIRT706422	hsa-miR-20b-5p	HITS-CLIP	22927820
MIRT706421	hsa-miR-519d-3p	HITS-CLIP	22927820
MIRT706420	hsa-miR-526b-3p	HITS-CLIP	22927820
MIRT706419	hsa-miR-93-5p	HITS-CLIP	22927820
MIRT706418	hsa-miR-302a-3p	HITS-CLIP	22927820
MIRT706417	hsa-miR-302b-3p	HITS-CLIP	22927820
MIRT706416	hsa-miR-302c-3p	HITS-CLIP	22927820
MIRT706415	hsa-miR-302d-3p	HITS-CLIP	22927820
MIRT706414	hsa-miR-302e	HITS-CLIP	22927820
MIRT706413	hsa-miR-372-3p	HITS-CLIP	22927820
MIRT706412	hsa-miR-373-3p	HITS-CLIP	22927820
MIRT706411	hsa-miR-520a-3p	HITS-CLIP	22927820
MIRT706410	hsa-miR-520b	HITS-CLIP	22927820
MIRT706409	hsa-miR-520c-3p	HITS-CLIP	22927820
MIRT706408	hsa-miR-520d-3p	HITS-CLIP	22927820
MIRT706407	hsa-miR-520e	HITS-CLIP	22927820
MIRT706406	hsa-miR-1245a	HITS-CLIP	22927820
MIRT706405	hsa-miR-8079	HITS-CLIP	22927820
MIRT706404	hsa-miR-512-3p	HITS-CLIP	22927820
MIRT706403	hsa-miR-520g-3p	HITS-CLIP	22927820
MIRT706402	hsa-miR-520h	HITS-CLIP	22927820
MIRT706401	hsa-miR-6513-3p	HITS-CLIP	22927820
MIRT703037	hsa-miR-186-3p	HITS-CLIP	22927820
MIRT703036	hsa-miR-1224-3p	HITS-CLIP	22927820
MIRT703035	hsa-miR-1234-3p	HITS-CLIP	22927820
MIRT703034	hsa-miR-7107-5p	HITS-CLIP	22927820
MIRT703033	hsa-miR-150-5p	HITS-CLIP	22927820
MIRT706400	hsa-miR-3653-5p	HITS-CLIP	22927820
MIRT706399	hsa-miR-6790-3p	HITS-CLIP	22927820
MIRT706398	hsa-miR-6821-3p	HITS-CLIP	22927820
MIRT703032	hsa-miR-6778-3p	HITS-CLIP	22927820
MIRT706397	hsa-miR-4731-5p	HITS-CLIP	22927820
MIRT706396	hsa-miR-5589-5p	HITS-CLIP	22927820
MIRT706395	hsa-miR-378a-5p	HITS-CLIP	22927820
MIRT706394	hsa-miR-640	HITS-CLIP	22927820
MIRT703050	hsa-miR-4698	HITS-CLIP	23313552
MIRT703049	hsa-miR-221-5p	HITS-CLIP	23313552
MIRT703048	hsa-miR-8073	HITS-CLIP	23313552
MIRT703047	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT703046	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT703045	hsa-miR-532-3p	HITS-CLIP	23313552
MIRT703043	hsa-miR-3176	HITS-CLIP	23313552
MIRT703044	hsa-miR-3922-3p	HITS-CLIP	23313552
MIRT703042	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT703041	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT703040	hsa-miR-188-3p	HITS-CLIP	23313552
MIRT703039	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT703038	hsa-miR-2114-3p	HITS-CLIP	23313552
MIRT703037	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT703036	hsa-miR-1224-3p	HITS-CLIP	23313552
MIRT703035	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT703034	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT703033	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT703032	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT703031	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT703030	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT657516	hsa-miR-488-3p	HITS-CLIP	23824327
MIRT657515	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT657514	hsa-miR-3133	HITS-CLIP	23824327
MIRT657513	hsa-miR-4511	HITS-CLIP	23824327
MIRT657512	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT657511	hsa-miR-5003-3p	HITS-CLIP	23824327
MIRT628173	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT628172	hsa-miR-8063	HITS-CLIP	23824327
MIRT628171	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT657510	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT628169	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT628173	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT628172	hsa-miR-8063	HITS-CLIP	23824327
MIRT628171	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT628170	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT628169	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT628168	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT628167	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT755313	hsa-miR-376b-3p	Western blottingMicroarrayqRT-PCR	37231239
MIRT755313	hsa-miR-376b-3p	Western blottingqRT-PCR	37231239
MIRT1040864	hsa-miR-1297	CLIP-seq
MIRT1040865	hsa-miR-141	CLIP-seq
MIRT1040866	hsa-miR-200a	CLIP-seq
MIRT1040867	hsa-miR-26a	CLIP-seq
MIRT1040868	hsa-miR-26b	CLIP-seq
MIRT1040869	hsa-miR-3153	CLIP-seq
MIRT1040870	hsa-miR-375	CLIP-seq
MIRT1040871	hsa-miR-4465	CLIP-seq
MIRT1040872	hsa-miR-4646-5p	CLIP-seq
MIRT1040873	hsa-miR-4668-5p	CLIP-seq
MIRT1040874	hsa-miR-511	CLIP-seq
MIRT1040875	hsa-miR-515-5p	CLIP-seq
MIRT1040876	hsa-miR-548ac	CLIP-seq
MIRT1040877	hsa-miR-548ae	CLIP-seq
MIRT1040878	hsa-miR-548aj	CLIP-seq
MIRT1040879	hsa-miR-548am	CLIP-seq
MIRT1040880	hsa-miR-548d-3p	CLIP-seq
MIRT1040881	hsa-miR-548x	CLIP-seq
MIRT1040882	hsa-miR-548z	CLIP-seq
MIRT1040883	hsa-miR-570	CLIP-seq
MIRT1549446	hsa-let-7a	CLIP-seq
MIRT1549447	hsa-let-7b	CLIP-seq
MIRT1549448	hsa-let-7c	CLIP-seq
MIRT1549449	hsa-let-7d	CLIP-seq
MIRT1549450	hsa-let-7e	CLIP-seq
MIRT1549451	hsa-let-7f	CLIP-seq
MIRT1549452	hsa-let-7g	CLIP-seq
MIRT1549453	hsa-let-7i	CLIP-seq
MIRT1549454	hsa-miR-1290	CLIP-seq
MIRT1549455	hsa-miR-1294	CLIP-seq
MIRT1549456	hsa-miR-202	CLIP-seq
MIRT1549457	hsa-miR-23a	CLIP-seq
MIRT1549458	hsa-miR-23b	CLIP-seq
MIRT1549459	hsa-miR-23c	CLIP-seq
MIRT1549460	hsa-miR-3174	CLIP-seq
MIRT1549461	hsa-miR-4422	CLIP-seq
MIRT1549462	hsa-miR-4436b-3p	CLIP-seq
MIRT1549463	hsa-miR-4458	CLIP-seq
MIRT1549464	hsa-miR-4500	CLIP-seq
MIRT1549465	hsa-miR-4704-3p	CLIP-seq
MIRT1549466	hsa-miR-4761-3p	CLIP-seq
MIRT1549467	hsa-miR-921	CLIP-seq
MIRT1549468	hsa-miR-98	CLIP-seq
MIRT2241000	hsa-miR-1256	CLIP-seq
MIRT2241001	hsa-miR-190	CLIP-seq
MIRT2241002	hsa-miR-190b	CLIP-seq
MIRT2241003	hsa-miR-3121-5p	CLIP-seq
MIRT2241004	hsa-miR-3689a-5p	CLIP-seq
MIRT2241005	hsa-miR-3689b	CLIP-seq
MIRT2241006	hsa-miR-3689e	CLIP-seq
MIRT2241007	hsa-miR-3689f	CLIP-seq
MIRT2241008	hsa-miR-500a	CLIP-seq
MIRT2241009	hsa-miR-654-3p	CLIP-seq
MIRT2241010	hsa-miR-9	CLIP-seq
MIRT2544561	hsa-miR-1183	CLIP-seq
MIRT2544562	hsa-miR-200b	CLIP-seq
MIRT2544563	hsa-miR-200c	CLIP-seq
MIRT2544564	hsa-miR-3064-3p	CLIP-seq
MIRT2544565	hsa-miR-3125	CLIP-seq
MIRT2544566	hsa-miR-3916	CLIP-seq
MIRT2544567	hsa-miR-429	CLIP-seq
MIRT2544568	hsa-miR-877	CLIP-seq
MIRT2544561	hsa-miR-1183	CLIP-seq
MIRT2544562	hsa-miR-200b	CLIP-seq
MIRT2544563	hsa-miR-200c	CLIP-seq
MIRT2544564	hsa-miR-3064-3p	CLIP-seq
MIRT2544565	hsa-miR-3125	CLIP-seq
MIRT2544566	hsa-miR-3916	CLIP-seq
MIRT2682220	hsa-miR-3928	CLIP-seq
MIRT2544567	hsa-miR-429	CLIP-seq
MIRT2544568	hsa-miR-877	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SP1	Repression	21795679
YY1	Repression	21795679

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000271	Process	Polysaccharide biosynthetic process	IBA
GO:0000271	Process	Polysaccharide biosynthetic process	IEA
GO:0000271	Process	Polysaccharide biosynthetic process	ISS
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0005515	Function	Protein binding	IPI	20507985, 25795779, 28604766
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	30394292
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	25795779, 30394292
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20522558, 25795779, 30394292
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	22016393
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030212	Process	Hyaluronan metabolic process	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IBA
GO:0030213	Process	Hyaluronan biosynthetic process	IDA	17324121, 30394292
GO:0030213	Process	Hyaluronan biosynthetic process	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IMP	20507985, 22016393
GO:0030213	Process	Hyaluronan biosynthetic process	ISS
GO:0030335	Process	Positive regulation of cell migration	IMP	22016393
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031982	Component	Vesicle	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0035810	Process	Positive regulation of urine volume	ISS
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IDA	17324121
GO:0036302	Process	Atrioventricular canal development	IEA
GO:0036302	Process	Atrioventricular canal development	ISS
GO:0042802	Function	Identical protein binding	IDA	20507985
GO:0044849	Process	Estrous cycle	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0050501	Function	Hyaluronan synthase activity	IBA
GO:0050501	Function	Hyaluronan synthase activity	IDA	30394292
GO:0050501	Function	Hyaluronan synthase activity	IEA
GO:0050501	Function	Hyaluronan synthase activity	IMP	22016393
GO:0050501	Function	Hyaluronan synthase activity	ISS
GO:0051549	Process	Positive regulation of keratinocyte migration	IEA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0070295	Process	Renal water absorption	IEA
GO:0070295	Process	Renal water absorption	ISS
GO:0071347	Process	Cellular response to interleukin-1	IEP	20522558
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	20522558
GO:0071498	Process	Cellular response to fluid shear stress	IEP	21551265
GO:0085029	Process	Extracellular matrix assembly	IBA
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0085029	Process	Extracellular matrix assembly	ISS
GO:0090500	Process	Endocardial cushion to mesenchymal transition	IEA
GO:0090500	Process	Endocardial cushion to mesenchymal transition	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900127	Process	Positive regulation of hyaluronan biosynthetic process	IEA
GO:1900625	Process	Positive regulation of monocyte aggregation	IMP	20522558
GO:1901201	Process	Regulation of extracellular matrix assembly	IEA
GO:1903561	Component	Extracellular vesicle	IDA	30394292

MIM	HGNC	e!Ensembl
601636	4819	ENSG00000170961

Q92819

Protein name

Hyaluronan synthase 2 (EC 2.4.1.212) (Hyaluronate synthase 2) (Hyaluronic acid synthase 2) (HA synthase 2)

Protein function

Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer (Probable) (PubMed:20507985, PubMed:21228273, PubMed:23303191, PubMed:32993960). Therefore, it is essential to hyaluronan synthesis a major component of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03142	Chitin_synth_2	193 → 367		Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in fibroblasts.

Sequence

MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ
SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI
DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKS
ICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG
DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY
NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR
EWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP
VSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR
KKGQQYDMVLDV

Sequence length

552

Interactions

View interactions

	Reactome
			Hyaluronan biosynthesis and export

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (110)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	11790779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30507579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31109321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14752026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21357421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30361541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29914429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	29914429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14752026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	14752026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14752026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	21378287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	35774294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20960509, 26490312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	22016393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16024615, 16125700, 16807238, 17315194, 22113945, 24527698, 25077968, 25081531, 27915342, 28086235, 28604766, 30194979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16807238, 22016393, 26722395, 27915342, 28086235, 29287594, 37705505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33506044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23202930, 31102316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	20875124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20960509, 26490312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28604766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	37232339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	21378287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23855769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	24347629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31102316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	37232339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	24558368		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	24558368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31562314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31562314, 31726413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	15890266, 23452080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23452080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32762950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	18776053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31189722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22960332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27716027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12015850, 29914429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29914429, 32776110, 33064966, 38616063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	32968816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33407998, 34546326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24558368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	24558368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23479332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	25276832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	25276832	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23965235	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21464983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	18776053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34307661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15610229, 21357421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18587729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27716027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27884164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	10987300, 24700772, 30857637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31189722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26352698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	21378287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26722395, 27884164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16024615, 16125700, 16807238, 17315194, 22113945, 24527698, 25081531, 27915342, 28086235, 28604766, 30194979, 31645543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28604766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27884164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20960509, 26490312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16807238, 21357421, 28086235, 28604766, 30974514, 31102316, 31645543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17315194		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21993555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27184066, 35580697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	23560496, 27184066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	15161000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	BEFREE	31526805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	23806178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26352698, 27884164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12239172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12239172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30143008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29163988		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31726413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26661071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14566823, 16807238, 17322391, 26490312, 27903965, 29914429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22960332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28460475, 29682180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24337597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	21357421, 23965235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35538609	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11171074, 15922739, 16540432, 21357421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15922739, 16540432, 16773198, 21357421, 30790335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15922739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25510701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23202930, 35767191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33506044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23916661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22904171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30614308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35938797	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38554337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21357421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21708929, 30130411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21357421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30790335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27884164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35264144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	24140236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	22162480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	21357421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32360595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20960509, 27595989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	24558368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	12720129		★★★★★ ★☆☆☆☆ Found in Text Mining only

HAS2 (hyaluronan synthase 2)