HAS1 (hyaluronan synthase 1)

Gene

• Entrez ID: 3036
• Gene name: Hyaluronan synthase 1
• Gene symbol: HAS1
• Synonyms (NCBI Gene): HAS
• Chromosome: 19
• Chromosome location: 19q13.41
• Summary: Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2544537	hsa-miR-1204	CLIP-seq
MIRT2544538	hsa-miR-2467-3p	CLIP-seq
MIRT2544539	hsa-miR-3176	CLIP-seq
MIRT2544540	hsa-miR-331-3p	CLIP-seq
MIRT2544541	hsa-miR-3677-3p	CLIP-seq
MIRT2544542	hsa-miR-3678-3p	CLIP-seq
MIRT2544543	hsa-miR-3919	CLIP-seq
MIRT2544544	hsa-miR-3922-3p	CLIP-seq
MIRT2544545	hsa-miR-3925-5p	CLIP-seq
MIRT2544546	hsa-miR-4279	CLIP-seq
MIRT2544547	hsa-miR-4508	CLIP-seq
MIRT2544548	hsa-miR-450b-5p	CLIP-seq
MIRT2544549	hsa-miR-4530	CLIP-seq
MIRT2544550	hsa-miR-4640-3p	CLIP-seq
MIRT2544551	hsa-miR-4649-3p	CLIP-seq
MIRT2544552	hsa-miR-4655-3p	CLIP-seq
MIRT2544553	hsa-miR-4660	CLIP-seq
MIRT2544554	hsa-miR-4738-3p	CLIP-seq
MIRT2544555	hsa-miR-4757-5p	CLIP-seq
MIRT2544556	hsa-miR-4779	CLIP-seq
MIRT2544557	hsa-miR-507	CLIP-seq
MIRT2544558	hsa-miR-557	CLIP-seq
MIRT2544559	hsa-miR-589	CLIP-seq
MIRT2544560	hsa-miR-646	CLIP-seq
MIRT2544537	hsa-miR-1204	CLIP-seq
MIRT2544538	hsa-miR-2467-3p	CLIP-seq
MIRT2544539	hsa-miR-3176	CLIP-seq
MIRT2544540	hsa-miR-331-3p	CLIP-seq
MIRT2682219	hsa-miR-3667-5p	CLIP-seq
MIRT2544541	hsa-miR-3677-3p	CLIP-seq
MIRT2544542	hsa-miR-3678-3p	CLIP-seq
MIRT2544543	hsa-miR-3919	CLIP-seq
MIRT2544544	hsa-miR-3922-3p	CLIP-seq
MIRT2544545	hsa-miR-3925-5p	CLIP-seq
MIRT2544546	hsa-miR-4279	CLIP-seq
MIRT2544547	hsa-miR-4508	CLIP-seq
MIRT2544548	hsa-miR-450b-5p	CLIP-seq
MIRT2544549	hsa-miR-4530	CLIP-seq
MIRT2544550	hsa-miR-4640-3p	CLIP-seq
MIRT2544551	hsa-miR-4649-3p	CLIP-seq
MIRT2544552	hsa-miR-4655-3p	CLIP-seq
MIRT2544553	hsa-miR-4660	CLIP-seq
MIRT2544554	hsa-miR-4738-3p	CLIP-seq
MIRT2544555	hsa-miR-4757-5p	CLIP-seq
MIRT2544556	hsa-miR-4779	CLIP-seq
MIRT2544557	hsa-miR-507	CLIP-seq
MIRT2544558	hsa-miR-557	CLIP-seq
MIRT2544559	hsa-miR-589	CLIP-seq
MIRT2544560	hsa-miR-646	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000271	Process	Polysaccharide biosynthetic process	IBA
GO:0000271	Process	Polysaccharide biosynthetic process	ISS
GO:0005515	Function	Protein binding	IPI	25795779
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	25795779
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25795779
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9169154
GO:0006024	Process	Glycosaminoglycan biosynthetic process	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	TAS	8798544
GO:0007155	Process	Cell adhesion	TAS	8798544
GO:0010764	Process	Negative regulation of fibroblast migration	IMP	19577615
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	IBA
GO:0030213	Process	Hyaluronan biosynthetic process	IEA
GO:0030213	Process	Hyaluronan biosynthetic process	TAS
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IDA	17324121
GO:0042802	Function	Identical protein binding	IPI	25795779
GO:0050501	Function	Hyaluronan synthase activity	IBA
GO:0050501	Function	Hyaluronan synthase activity	IEA
GO:0050501	Function	Hyaluronan synthase activity	ISS
GO:0050501	Function	Hyaluronan synthase activity	TAS
GO:0085029	Process	Extracellular matrix assembly	IBA
GO:0085029	Process	Extracellular matrix assembly	ISS

Other IDs

• MIM: 601463
• HGNC: 4818
• e!Ensembl: ENSG00000105509

Protein

• UniProt ID: Q92839
• Protein name: Hyaluronan synthase 1 (EC 2.4.1.212) (Hyaluronate synthase 1) (Hyaluronic acid synthase 1) (HA synthase 1) (HuHAS1)
• Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13641	Glyco_tranf_2_3	178 → 382		Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highly expressed in ovary followed by spleen, thymus, prostate, testes and large intestine. Weakly expressed in small intestine. {ECO:0000269|PubMed:8651928}.
• Sequence:

  MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYG
  AFLSAHLVAQSLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARA
  LLYPRARLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGA
  GAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDT
  RLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFH
  CVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSR
  CYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL
  RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLAL
  VTMNQSGWGTSGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYH
  LAAGAGAYVGYWVAMLTLYWVGVRRLCRRRTGGYRVQV

• Sequence length: 578

Pathways

Reactome:

Hyaluronan biosynthesis and export

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations