HABP2 (hyaluronan binding protein 2)

Gene

• Entrez ID: 3026
• Gene name: Hyaluronan binding protein 2
• Gene symbol: HABP2
• Synonyms (NCBI Gene): FSAP, HABP, HGFAL, NMTC5, PHBP, PHBSP
• Chromosome: 10
• Chromosome location: 10q25.3
• Summary: This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis lead

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1040310	hsa-miR-214	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040312	hsa-miR-3619-5p	CLIP-seq
MIRT1040313	hsa-miR-3646	CLIP-seq
MIRT1040314	hsa-miR-4291	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040316	hsa-miR-4786-3p	CLIP-seq
MIRT1040317	hsa-miR-4799-5p	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040319	hsa-miR-761	CLIP-seq
MIRT1040320	hsa-miR-922	CLIP-seq
MIRT1040321	hsa-miR-2467-5p	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040322	hsa-miR-331-3p	CLIP-seq
MIRT1040323	hsa-miR-3612	CLIP-seq
MIRT1040324	hsa-miR-3689d	CLIP-seq
MIRT1040325	hsa-miR-4254	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040326	hsa-miR-4308	CLIP-seq
MIRT1040327	hsa-miR-4443	CLIP-seq
MIRT1040328	hsa-miR-516b	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040329	hsa-miR-579	CLIP-seq
MIRT1040330	hsa-miR-650	CLIP-seq
MIRT1040331	hsa-miR-760	CLIP-seq
MIRT2008404	hsa-miR-19a	CLIP-seq
MIRT2008405	hsa-miR-19b	CLIP-seq
MIRT2008406	hsa-miR-3145-3p	CLIP-seq
MIRT2008407	hsa-miR-593	CLIP-seq
MIRT2450941	hsa-miR-4436b-3p	CLIP-seq
MIRT2450942	hsa-miR-4532	CLIP-seq
MIRT2450943	hsa-miR-4640-5p	CLIP-seq
MIRT2450944	hsa-miR-4685-5p	CLIP-seq
MIRT2450945	hsa-miR-4690-3p	CLIP-seq
MIRT2450946	hsa-miR-4726-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	TAS	8827452
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	8827452
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	11217080
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	TAS	8827452
GO:0008233	Function	Peptidase activity	IDA	11217080
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 603924
• HGNC: 4798
• e!Ensembl: ENSG00000148702

Protein

• UniProt ID: Q14520
• Protein name: Factor VII-activating protease (FSAP) (EC 3.4.21.-) (FVII activator) (Hepatocyte growth factor activator-like protein) (Hyaluronan-binding protein 2) (Plasma hyaluronan-binding protein) (PHBP) (Plasma hyaluronan-binding serine protease) (PHBSP) [Cleaved i
• Protein function: Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly (PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00008	EGF	77 → 107	EGF-like domain	Domain
  PF00008	EGF	154 → 186	EGF-like domain	Domain
  PF00051	Kringle	194 → 276	Kringle domain	Domain
  PF00089	Trypsin	314 → 550	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8827452}.
• Sequence:

  MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
  HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
  GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
  QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
  GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
  CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA
  AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
  DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
  QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
  TQVTKFLNWIKATIKSESGF

• Sequence length: 560

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Factor VII Marburg I Variant Thrombophilia	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FACTOR VII-ACTIVATING PROTEASE MARBURG I POLYMORPHISM	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PAPILLARY OR FOLLICULAR THYROID CARCINOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HABP2-related disorder	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia due to thrombin defect	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 5	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar CTD, ClinVar CTD, ClinVar	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THYROID CANCER, NONMEDULLARY, 5, SUSCEPTIBILITY TO	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous thromboembolism, susceptibility to	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	12386823		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15543324, 18278176, 28726978		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15543324, 18278176, 28726978		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15543324		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28402931, 29665850		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28402931, 29665850	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24278187	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38110372	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17145954, 28246168, 28548975		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19446554	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	12578864, 15486068, 17145954, 28881271		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	15486068, 21393601	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	32856552	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22409238	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21114618, 26732560, 28670395, 28726978, 28881271		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19105210		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29927903		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22850287	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29927903		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29927903	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29927903		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	18394684, 22409238, 22421107		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28651521		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19105210		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19105210		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25370187	Stimulate	★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	22989567		★☆☆☆☆ Found in Text Mining only
familial non-medullary thyroid cancer	Thyroid cancer	BEFREE	27873212, 28779995		★☆☆☆☆ Found in Text Mining only
Familial Nonmedullary Thyroid Cancer	Thyroid cancer	BEFREE	26222560, 26832773, 27530615, 28222214		★☆☆☆☆ Found in Text Mining only
Familial papillary or follicular thyroid carcinoma	Thyroid Carcinoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	19105210, 22989567, 27462075, 28726978		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	29385837	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	22409238, 28501930		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	28651521		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	39273271	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19105210		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19446554, 38110372	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26626052	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28402931, 29665850		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26222560, 26832773, 27530615, 28222214		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28222214, 28402931, 28726978		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26906432		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30143058		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22850287	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29927903		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26222560, 26745718, 27530615, 28089742, 28222214		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17016581		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	BEFREE	29895015		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28651521, 35538609	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36978087	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26745718, 26832773, 28089742, 28222214, 28402931, 28779995, 29895015, 30826992		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20818495		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17540775, 20818495		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	17540775		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22247771		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	22247771	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	25370187	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29296900		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12386823		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21114618	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	22421107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis of cerebral veins	Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26222560, 26745718, 26832773, 28402931	Associate	★☆☆☆☆ Found in Text Mining only
THYROID CANCER, NONMEDULLARY, 5	Thyroid Cancer	UNIPROT_DG	12578864, 26222560		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THYROID CANCER, NONMEDULLARY, 5	Thyroid Cancer	GENOMICS_ENGLAND_DG	28222214		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
THYROID CANCER, NONMEDULLARY, 5	Thyroid Cancer	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26222560, 26832773, 27530615, 28222214		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26222560, 26832773, 27530615, 28222214		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26222560, 27530615	Associate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29385837		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	15486068, 19552680	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19552680	Inhibit	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	22409238	Associate	★☆☆☆☆ Found in Text Mining only