ANXA2 (annexin A2)

Gene

• Entrez ID: 302
• Gene name: Annexin A2
• Gene symbol: ANXA2
• Synonyms (NCBI Gene): ANX2, ANX2L4, CAL1H, HEL-S-270, LIP2, LPC2, LPC2D, P36, PAP-IV
• Chromosome: 15
• Chromosome location: 15q22.2
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor whi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001388	hsa-miR-1-3p	pSILAC	18668040
MIRT020897	hsa-miR-155-5p	Proteomics	18668040
MIRT001388	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT001388	hsa-miR-1-3p	Proteomics	18668040
MIRT045844	hsa-miR-132-3p	CLASH	23622248
MIRT039126	hsa-miR-769-3p	CLASH	23622248
MIRT020897	hsa-miR-155-5p	Immunocytochemistry, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24604078
MIRT001388	hsa-miR-1-3p	qRT-PCR, Western blot	24310399
MIRT437953	hsa-miR-133a-3p	In situ hybridization, Microarray, qRT-PCR, Luciferase reporter assay, Western blot	24715690
MIRT437953	hsa-miR-133a-3p	In situ hybridization, Microarray, qRT-PCR, Luciferase reporter assay, Western blot	24715690
MIRT437953	hsa-miR-133a-3p	In situ hybridization, Microarray, qRT-PCR, Luciferase reporter assay, Western blot	24715690
MIRT437953	hsa-miR-133a-3p	In situ hybridization, Microarray, qRT-PCR, Luciferase reporter assay, Western blot	24715690
MIRT441218	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441218	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731150	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Immunohistochemistry, Western blot	25500542
MIRT731150	hsa-miR-206	MiaPaca-2	25500542
MIRT733613	hsa-miR-342-3p	Luciferase reporter assay, qRT-PCR, Western blotting	34055578
MIRT733738	hsa-miR-126-3p	Immunoprecipitaion (IP), In situ hybridization, Western blotting	33842542
MIRT736516	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32531042
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786469	hsa-miR-3676	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786473	hsa-miR-4263	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786475	hsa-miR-4509	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786476	hsa-miR-4744	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT786478	hsa-miR-4799-5p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786484	hsa-miR-548a-5p	CLIP-seq
MIRT786485	hsa-miR-548ab	CLIP-seq
MIRT786486	hsa-miR-548ak	CLIP-seq
MIRT786487	hsa-miR-548b-5p	CLIP-seq
MIRT786488	hsa-miR-548c-5p	CLIP-seq
MIRT786489	hsa-miR-548d-5p	CLIP-seq
MIRT786490	hsa-miR-548h	CLIP-seq
MIRT786491	hsa-miR-548i	CLIP-seq
MIRT786492	hsa-miR-548j	CLIP-seq
MIRT786493	hsa-miR-548k	CLIP-seq
MIRT786494	hsa-miR-548l	CLIP-seq
MIRT786495	hsa-miR-548w	CLIP-seq
MIRT786496	hsa-miR-548y	CLIP-seq
MIRT786497	hsa-miR-559	CLIP-seq
MIRT786498	hsa-miR-576-5p	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786501	hsa-miR-671-5p	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786501	hsa-miR-671-5p	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT1931950	hsa-miR-1299	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT1931951	hsa-miR-29a	CLIP-seq
MIRT1931952	hsa-miR-29b	CLIP-seq
MIRT1931953	hsa-miR-29c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT1931954	hsa-miR-3663-3p	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT1931955	hsa-miR-378	CLIP-seq
MIRT1931956	hsa-miR-378b	CLIP-seq
MIRT1931957	hsa-miR-378c	CLIP-seq
MIRT1931958	hsa-miR-378d	CLIP-seq
MIRT1931959	hsa-miR-378e	CLIP-seq
MIRT1931960	hsa-miR-378f	CLIP-seq
MIRT1931961	hsa-miR-378h	CLIP-seq
MIRT1931962	hsa-miR-378i	CLIP-seq
MIRT1931963	hsa-miR-422a	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786475	hsa-miR-4509	CLIP-seq
MIRT1931964	hsa-miR-4638-3p	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT1931965	hsa-miR-4710	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786476	hsa-miR-4744	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT1931966	hsa-miR-4782-5p	CLIP-seq
MIRT1931967	hsa-miR-4792	CLIP-seq
MIRT786478	hsa-miR-4799-5p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT1931968	hsa-miR-516b	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786484	hsa-miR-548a-5p	CLIP-seq
MIRT786485	hsa-miR-548ab	CLIP-seq
MIRT786486	hsa-miR-548ak	CLIP-seq
MIRT786487	hsa-miR-548b-5p	CLIP-seq
MIRT786488	hsa-miR-548c-5p	CLIP-seq
MIRT786489	hsa-miR-548d-5p	CLIP-seq
MIRT786490	hsa-miR-548h	CLIP-seq
MIRT786491	hsa-miR-548i	CLIP-seq
MIRT786492	hsa-miR-548j	CLIP-seq
MIRT786493	hsa-miR-548k	CLIP-seq
MIRT786494	hsa-miR-548l	CLIP-seq
MIRT786495	hsa-miR-548w	CLIP-seq
MIRT786496	hsa-miR-548y	CLIP-seq
MIRT786497	hsa-miR-559	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786501	hsa-miR-671-5p	CLIP-seq
MIRT1931969	hsa-miR-767-5p	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT2172415	hsa-miR-1226	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786469	hsa-miR-3676	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786473	hsa-miR-4263	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786475	hsa-miR-4509	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT2172416	hsa-miR-4733-3p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786476	hsa-miR-4744	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT786478	hsa-miR-4799-5p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786484	hsa-miR-548a-5p	CLIP-seq
MIRT786485	hsa-miR-548ab	CLIP-seq
MIRT786486	hsa-miR-548ak	CLIP-seq
MIRT786487	hsa-miR-548b-5p	CLIP-seq
MIRT786488	hsa-miR-548c-5p	CLIP-seq
MIRT786489	hsa-miR-548d-5p	CLIP-seq
MIRT786490	hsa-miR-548h	CLIP-seq
MIRT786491	hsa-miR-548i	CLIP-seq
MIRT786492	hsa-miR-548j	CLIP-seq
MIRT786493	hsa-miR-548k	CLIP-seq
MIRT786494	hsa-miR-548l	CLIP-seq
MIRT786495	hsa-miR-548w	CLIP-seq
MIRT786496	hsa-miR-548y	CLIP-seq
MIRT786497	hsa-miR-559	CLIP-seq
MIRT786498	hsa-miR-576-5p	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786438	hsa-miR-425	CLIP-seq
MIRT786441	hsa-miR-4328	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786484	hsa-miR-548a-5p	CLIP-seq
MIRT786485	hsa-miR-548ab	CLIP-seq
MIRT786486	hsa-miR-548ak	CLIP-seq
MIRT786487	hsa-miR-548b-5p	CLIP-seq
MIRT786488	hsa-miR-548c-5p	CLIP-seq
MIRT786489	hsa-miR-548d-5p	CLIP-seq
MIRT786490	hsa-miR-548h	CLIP-seq
MIRT786491	hsa-miR-548i	CLIP-seq
MIRT786492	hsa-miR-548j	CLIP-seq
MIRT786493	hsa-miR-548k	CLIP-seq
MIRT786494	hsa-miR-548l	CLIP-seq
MIRT786495	hsa-miR-548w	CLIP-seq
MIRT786496	hsa-miR-548y	CLIP-seq
MIRT786497	hsa-miR-559	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786462	hsa-miR-664	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT1931950	hsa-miR-1299	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT1931951	hsa-miR-29a	CLIP-seq
MIRT1931952	hsa-miR-29b	CLIP-seq
MIRT1931953	hsa-miR-29c	CLIP-seq
MIRT2475346	hsa-miR-3160-5p	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT1931954	hsa-miR-3663-3p	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT2475347	hsa-miR-3685	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT1931955	hsa-miR-378	CLIP-seq
MIRT1931956	hsa-miR-378b	CLIP-seq
MIRT1931957	hsa-miR-378c	CLIP-seq
MIRT1931958	hsa-miR-378d	CLIP-seq
MIRT1931959	hsa-miR-378e	CLIP-seq
MIRT1931960	hsa-miR-378f	CLIP-seq
MIRT1931961	hsa-miR-378h	CLIP-seq
MIRT1931962	hsa-miR-378i	CLIP-seq
MIRT1931963	hsa-miR-422a	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT1931964	hsa-miR-4638-3p	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT2475348	hsa-miR-4659a-3p	CLIP-seq
MIRT2475349	hsa-miR-4659b-3p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT1931965	hsa-miR-4710	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT1931966	hsa-miR-4782-5p	CLIP-seq
MIRT1931967	hsa-miR-4792	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT1931968	hsa-miR-516b	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786501	hsa-miR-671-5p	CLIP-seq
MIRT1931969	hsa-miR-767-5p	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq
MIRT786463	hsa-miR-1	CLIP-seq
MIRT786431	hsa-miR-101	CLIP-seq
MIRT786464	hsa-miR-1206	CLIP-seq
MIRT786424	hsa-miR-1275	CLIP-seq
MIRT1931950	hsa-miR-1299	CLIP-seq
MIRT786425	hsa-miR-155	CLIP-seq
MIRT786432	hsa-miR-185	CLIP-seq
MIRT786433	hsa-miR-23a	CLIP-seq
MIRT786434	hsa-miR-23b	CLIP-seq
MIRT786435	hsa-miR-23c	CLIP-seq
MIRT1931951	hsa-miR-29a	CLIP-seq
MIRT1931952	hsa-miR-29b	CLIP-seq
MIRT1931953	hsa-miR-29c	CLIP-seq
MIRT2475346	hsa-miR-3160-5p	CLIP-seq
MIRT786465	hsa-miR-3189-3p	CLIP-seq
MIRT786436	hsa-miR-3199	CLIP-seq
MIRT786466	hsa-miR-320e	CLIP-seq
MIRT786437	hsa-miR-3612	CLIP-seq
MIRT786426	hsa-miR-3620	CLIP-seq
MIRT786467	hsa-miR-3662	CLIP-seq
MIRT1931954	hsa-miR-3663-3p	CLIP-seq
MIRT786468	hsa-miR-3673	CLIP-seq
MIRT786470	hsa-miR-3684	CLIP-seq
MIRT2475347	hsa-miR-3685	CLIP-seq
MIRT786471	hsa-miR-376a	CLIP-seq
MIRT786472	hsa-miR-376b	CLIP-seq
MIRT1931955	hsa-miR-378	CLIP-seq
MIRT1931956	hsa-miR-378b	CLIP-seq
MIRT1931957	hsa-miR-378c	CLIP-seq
MIRT1931958	hsa-miR-378d	CLIP-seq
MIRT1931959	hsa-miR-378e	CLIP-seq
MIRT1931960	hsa-miR-378f	CLIP-seq
MIRT1931961	hsa-miR-378h	CLIP-seq
MIRT1931962	hsa-miR-378i	CLIP-seq
MIRT1931963	hsa-miR-422a	CLIP-seq
MIRT786439	hsa-miR-4305	CLIP-seq
MIRT786440	hsa-miR-4306	CLIP-seq
MIRT786474	hsa-miR-4423-3p	CLIP-seq
MIRT786442	hsa-miR-4459	CLIP-seq
MIRT786443	hsa-miR-4476	CLIP-seq
MIRT786444	hsa-miR-4493	CLIP-seq
MIRT1931964	hsa-miR-4638-3p	CLIP-seq
MIRT786445	hsa-miR-4644	CLIP-seq
MIRT786446	hsa-miR-4645-5p	CLIP-seq
MIRT786447	hsa-miR-4652-5p	CLIP-seq
MIRT2475348	hsa-miR-4659a-3p	CLIP-seq
MIRT2475349	hsa-miR-4659b-3p	CLIP-seq
MIRT786427	hsa-miR-4665-5p	CLIP-seq
MIRT786448	hsa-miR-4672	CLIP-seq
MIRT786449	hsa-miR-4673	CLIP-seq
MIRT786450	hsa-miR-4695-5p	CLIP-seq
MIRT786451	hsa-miR-4700-3p	CLIP-seq
MIRT786428	hsa-miR-4701-5p	CLIP-seq
MIRT1931965	hsa-miR-4710	CLIP-seq
MIRT786452	hsa-miR-4742-5p	CLIP-seq
MIRT786453	hsa-miR-4753-5p	CLIP-seq
MIRT786454	hsa-miR-4755-3p	CLIP-seq
MIRT786455	hsa-miR-4768-3p	CLIP-seq
MIRT786477	hsa-miR-4777-5p	CLIP-seq
MIRT1931966	hsa-miR-4782-5p	CLIP-seq
MIRT1931967	hsa-miR-4792	CLIP-seq
MIRT786456	hsa-miR-5095	CLIP-seq
MIRT786429	hsa-miR-513a-5p	CLIP-seq
MIRT1931968	hsa-miR-516b	CLIP-seq
MIRT786479	hsa-miR-518d-5p	CLIP-seq
MIRT786480	hsa-miR-519b-5p	CLIP-seq
MIRT786481	hsa-miR-519c-5p	CLIP-seq
MIRT786482	hsa-miR-520c-5p	CLIP-seq
MIRT786457	hsa-miR-520g	CLIP-seq
MIRT786458	hsa-miR-520h	CLIP-seq
MIRT786483	hsa-miR-526a	CLIP-seq
MIRT786499	hsa-miR-579	CLIP-seq
MIRT786430	hsa-miR-588	CLIP-seq
MIRT786459	hsa-miR-600	CLIP-seq
MIRT786500	hsa-miR-613	CLIP-seq
MIRT786460	hsa-miR-642b	CLIP-seq
MIRT786461	hsa-miR-650	CLIP-seq
MIRT786501	hsa-miR-671-5p	CLIP-seq
MIRT1931969	hsa-miR-767-5p	CLIP-seq
MIRT786502	hsa-miR-9	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEP	11866539
GO:0001533	Component	Cornified envelope	IEA
GO:0001765	Process	Membrane raft assembly	IMP	23861394
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001921	Process	Positive regulation of receptor recycling	IDA	22848640
GO:0001921	Process	Positive regulation of receptor recycling	IEA
GO:0002020	Function	Protease binding	IPI	22848640
GO:0002091	Process	Negative regulation of receptor internalization	IDA	18799458
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0004859	Function	Phospholipase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	22848640
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	14522961, 18799458, 19724273, 20706999, 20849852, 21044950, 21339331, 21645192, 21886777, 22301157, 22587461, 23861394, 24457100, 25136068, 25139904, 25362534, 26030842, 26812398, 28669632, 29636414, 30021884, 30853625, 31160551, 31210752, 33310911, 33961781, 35063084, 35384245, 392
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IDA	2138016
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IMP	23861394
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21645192, 25139904, 26812398
GO:0005737	Component	Cytoplasm	IEA
GO:0005765	Component	Lysosomal membrane	IDA	23360953
GO:0005768	Component	Endosome	IDA	18767904, 21645192
GO:0005769	Component	Early endosome	IEA
GO:0005811	Component	Lipid droplet	IDA	14741744
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	3126079, 18799458
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	3126079
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0006900	Process	Vesicle budding from membrane	IMP	23861394
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0009986	Component	Cell surface	IDA	10809787, 25139904
GO:0009986	Component	Cell surface	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IBA
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	9836589
GO:0012506	Component	Vesicle membrane	IBA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016363	Component	Nuclear matrix	NAS	23415230
GO:0019834	Function	Phospholipase A2 inhibitor activity	IDA	3013422
GO:0019834	Function	Phospholipase A2 inhibitor activity	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030324	Process	Lung development	IEA
GO:0030496	Component	Midbody	IDA	15166316
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031340	Process	Positive regulation of vesicle fusion	IDA	2138016
GO:0031340	Process	Positive regulation of vesicle fusion	IEA
GO:0031902	Component	Late endosome membrane	IDA	23360953
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032804	Process	Negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	22848640
GO:0032804	Process	Negative regulation of low-density lipoprotein particle receptor catabolic process	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035749	Component	Myelin sheath adaxonal region	IEA
GO:0036035	Process	Osteoclast development	IDA	7961821
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042730	Process	Fibrinolysis	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISO
GO:0042802	Function	Identical protein binding	IPI	18799458, 26812398
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0044090	Process	Positive regulation of vacuole organization	IMP	25139904
GO:0044548	Function	S100 protein binding	IPI	14699089, 23091277
GO:0045121	Component	Membrane raft	IDA	14699089
GO:0045921	Process	Positive regulation of exocytosis	NAS	22940583
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	15226301
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISO
GO:0051051	Process	Negative regulation of transport	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503, 23533145
GO:0070062	Component	Extracellular exosome	IDA	22057634
GO:0070062	Component	Extracellular exosome	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	23415230
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:0098797	Component	Plasma membrane protein complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IPI	9886297, 23275167
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1905581	Process	Positive regulation of low-density lipoprotein particle clearance	IDA	22848640
GO:1905581	Process	Positive regulation of low-density lipoprotein particle clearance	IEA
GO:1905602	Process	Positive regulation of receptor-mediated endocytosis involved in cholesterol transport	IDA	22848640
GO:1905602	Process	Positive regulation of receptor-mediated endocytosis involved in cholesterol transport	IEA
GO:1905686	Process	Positive regulation of plasma membrane repair	NAS	22940583
GO:1990665	Component	AnxA2-p11 complex	IDA	23861394
GO:1990667	Component	PCSK9-AnxA2 complex	IDA	22848640
GO:1990667	Component	PCSK9-AnxA2 complex	IPI	24808179

Other IDs

• MIM: 151740
• HGNC: 537
• e!Ensembl: ENSG00000182718

Protein

• UniProt ID: P07355
• Protein name: Annexin A2 (Annexin II) (Annexin-2) (Calpactin I heavy chain) (Calpactin-1 heavy chain) (Chromobindin-8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP-IV) (Protein I) (p36)
• Protein function: Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation,
• PDB: 1W7B, 1XJL, 2HYU, 2HYV, 2HYW, 4DRW, 4FTG, 4HRH, 5LPU, 5LPX, 5LQ0, 5LQ2, 5N7D, 5N7F, 5N7G, 6TWQ, 6TWU, 6TWX, 6TWY, 7DTO, 7EQ7, 7NMI, 7P70, 7P71, 7P72, 7P73, 7P74, 7PC3, 7PC4, 7PC5, 7PC7, 7PC8, 7PC9, 7PCB, 7QQL, 7QQM, 7QQN, 7ZVN, 7ZVX, 8AEL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	37 → 102	Annexin	Family
  PF00191	Annexin	109 → 174	Annexin	Family
  PF00191	Annexin	193 → 259	Annexin	Family
  PF00191	Annexin	269 → 334	Annexin	Family

• Sequence:

  MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNIL
  TNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKG
  LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
  EDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDM
  LESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
  LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

• Sequence length: 339

Pathways

KEGG:

Salmonella infection

Reactome:

Neutrophil degranulation
Dissolution of Fibrin Clot
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30474876		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10099141, 11108960, 11795262, 12165291, 15070701, 15567461, 16197459, 21146216, 22855149, 28687976, 31370070		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	27640198		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15526283		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17054434, 22855149, 25347154, 28178129, 31325182, 8269629		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20429620		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31821092		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	14633604, 18289715		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	30694461		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	1333884		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15784727	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	16450333, 29749431, 30355917, 31113479		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	16493010		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	16493010, 18759277, 22288586	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	18434302, 21440088, 31059997		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22226179	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	18502476		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	18502476		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	31856737	Inhibit	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	36226463	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11739291		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15642131	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15051937		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24111848		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24111848	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	1333884		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23737970	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11739291		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	8898868		★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	BEFREE	9190936		★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	9190936		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25641213, 28963375		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28963375	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	25416440		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29805562		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	30569159		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	30569159	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26637476, 31695759		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	11795262, 15567461, 29724147		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	21817168	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11461077, 11536309, 12962548, 23116197		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	12962548	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20079732, 20383413, 22452352, 22917188, 23792445, 26253946, 26307676, 27754360, 27760843, 28470457, 28476852, 29568351, 30478786, 31113450		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10777578, 12962548, 22917188, 22957061, 27754360, 32629869, 36046013, 36229838	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	21918681	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	27353274	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	18384219		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31912102	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12959682, 14613585, 19656851, 25917452		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	17695432	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17550317, 28178129	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17659677, 2160596, 23139605, 23840117, 23950866, 25428919, 26057582, 26109000, 26547929, 27121050, 28963461, 29332450, 30588744, 30881525, 33121269, 34047479, 38114725	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26189841, 37117324	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	27422542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26637476, 31695759		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29285166		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18008140, 21688086, 23339919, 24727000, 28178129, 30518184		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25416440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25520129, 31171367	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17083565, 19513064, 25926002, 31912102	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11504947, 27402115, 28178129, 37783508	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23945256, 25362534, 25416440, 26925708, 27890659, 30572596, 30621740, 31092442, 31210752		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	38277535	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	9515022		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	10903884	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	11536309		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31242951		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25347736		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31242951		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	30694461		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	15051937		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28943392		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38082327	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	28943450	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	19823170	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29545968		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	25284003		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29691673, 30050103, 31172894		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16207476, 32671503, 33407563, 40069612	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18071363, 30050103	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25287627	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	30569159		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23713052, 9515022		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15338305, 25284003		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31783201, 9515022		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31783201, 9515022		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28456096	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28456096, 31783201, 9515022		★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	38277535	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10398839, 11118734		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	28536720		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10567346		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22970290	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10567346, 28487977		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27353274	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33335142, 35991124	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	20607799		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	14553951		★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	BEFREE	28334824		★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Dysferlinopathy	Pubtator	39350328	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21868071		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21715543, 27784647, 31842290		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26362938	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23340055, 30071521		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32106990, 34055578	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31092442		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25416440		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	12845669, 30081903		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12378614	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12845669, 30081903		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25605255	Associate	★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	20607799		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28377286		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	25880590		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27191262		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27191262	Associate	★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	10712583		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	7961821		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	32913388	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1333884, 19351187, 23116197, 24310399, 25697644, 27429043, 27667176, 30898167, 31430050		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23737970, 27667176, 35327982	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	1333884, 19351187, 23116197, 24310399, 25697644, 27429043, 27667176, 30898167, 31430050		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10777578, 25054228, 33712571, 34675316, 35581384	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	1333884, 23082878, 31115554		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	23334362		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	BEFREE	10712583		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28196356		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12090472		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33387869	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10701682	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23713052, 9515022		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	LHGDN	17239928		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	10099141, 15070701, 16197459	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15302870	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	16524621		★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	LHGDN	16524621		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23139605	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	28943392		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	LHGDN	18799458		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35789607, 36589842	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28283478		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31336797	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10398839		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	39735982	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	12699894		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	LHGDN	12699894		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10701682	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31912102	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	8862592		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10099141, 15070701, 15567461, 23334362		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10099141, 15070701	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10099141, 15070701, 15302870, 16197459, 22327096	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12547161, 30694461		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16820872, 17659677, 17786358, 18059140, 19020748, 19885616, 2160596, 22855149, 23139605, 23840117, 23950866, 25385370, 26109000, 26547929, 27060670, 27634758, 28976984, 29123978, 29228983, 29545968, 30272362, 30588744, 30853625, 30881525, 30935762, 31172894, 7542850		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19020748		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29545968		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	19823170	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	39273539	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30569159	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	25385370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	11504947, 21688086, 23339919, 31865638, 36806050	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20682992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	24727000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	8557639		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	8557639		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	8557639		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20847146, 28183811, 30344652		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	8557639		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18384219, 25287627	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22681645, 25362534, 33658625	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26109000, 26362938, 29097873	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12200383		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	1333884, 25697644		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12090472		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	20682992		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	11536309		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20079732, 20383413, 22452352, 22917188, 23792445, 26253946, 26307676, 27754360, 27760843, 28470457, 28476852, 29568351, 30478786, 31113450		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27784647, 31842290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12845669, 30081903		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27191262		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	25284003		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29285166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19885616, 28963461, 31807177		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18008140, 21688086, 23339919, 24727000, 28178129, 30518184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20682992		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	18384219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23945256, 25362534, 26925708, 27890659, 30572596, 30621740, 31210752		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12962548, 16450333, 17671195, 18712570, 20686216, 21572519, 25611381, 26243191, 29290958, 31255446, 31463696, 8269629		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11522620, 11536309, 12629510, 12962548, 14613585, 19452941, 20121258, 22223826, 22855149, 25139998, 25344575, 29187477, 29805562		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22681645, 24289616, 25034653, 25150310, 26812398, 28609840, 29097873, 31186633		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26637476, 31695759		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11522620, 12547161, 18712570, 22044461, 22185818, 22855149, 22859294, 22917188, 23522334, 24289616, 24489826, 24591759, 24727000, 25611381, 26253946, 26438086, 26456389, 26716413, 27760843, 28867585, 28967196, 29115416, 29508276, 29749431, 30050103, 30572596, 30853625, 30898167, 31113450, 31172894, 31186633, 31463696, 9139835		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31242951		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14522961, 16643892		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22044461, 26272794		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23056502, 8976730	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25480418		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25480418, 26672724	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29444639		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29805562		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	12200383, 19585213, 22223826, 22705595, 28344315, 29906496		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12200383, 22705595	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28651352		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	LHGDN	16100712		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18084608		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18084608	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	28334824		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18384219, 22855149, 26196246, 29598816		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18384219, 26196246	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10616197, 11461077, 11536309, 12547161, 15036650, 16197719, 18822406, 19452941, 19885616, 20079732, 20607799, 22185818, 22487537, 22681645, 22855149, 22859294, 23494179, 23840117, 24727000, 25139998, 25150310, 25284003, 25344575, 25462861, 25500542, 25611381, 26109000, 26272794, 27429043, 28152318, 28476852, 28652618, 29097873, 29217762, 29290958, 29508276, 29567212, 30050103, 30081903, 30355917, 30935762, 31115554, 31171367, 31325182, 7700633, 9482108		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20847146, 28183811		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	27612997		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29786451		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10616197, 28814318, 7700633		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36916296	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	7738588		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10512675, 22859294, 23494179, 28178129, 28886730, 29253515, 30854114, 31305682		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	27422542		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29444639, 30462534		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal Syndrome	BEFREE	19022301		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	31572534		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	21817168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	21817168	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11672768, 15211578, 29462818		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15211578		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29462818, 33414451, 40481236	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23945256, 25362534, 26925708, 27890659, 30572596, 30621740, 31210752		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25362534, 25416440, 26362938, 30621740, 33955501, 34725902, 38102461	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31474227	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12962548, 16450333, 17671195, 18712570, 20686216, 21572519, 25611381, 26243191, 29290958, 31255446, 31463696, 8269629		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	16450333, 30355917, 31171367		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18712570		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	8269629		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12962548, 17496331, 19724273, 20686216, 25611381, 35789607	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36671463	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	9482108		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	31213128		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	10398839, 11118734		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21572519, 26243191, 28152318, 29290958		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36750863	Associate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	27449504, 31059997		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15070701		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28476852		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	28943450		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11522620, 11536309, 12629510, 12962548, 14613585, 19452941, 20121258, 22223826, 22855149, 25139998, 25344575, 29187477, 29805562		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	12962548, 17550317	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16916997	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	12962548, 19452941, 20121258		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	15944914		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12629510, 14613585, 15944914, 18636554, 18924133		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12962548, 16916997, 17550317	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18211896, 25344575, 29682763, 32967771, 36224238	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19452941		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21311769		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29172997, 30902828		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	25284003		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25284003		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	25139904		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24884814	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21788340		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30426384		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	8862592		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	26307676		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28404907	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34064456	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10512675, 1314068		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1314068	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18822406, 22855149, 27889534, 28178129		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24626613, 24668792, 30081903		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20497865, 31517839, 33658625	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23996702, 24798676		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22681645, 24289616, 25034653, 25150310, 26812398, 28609840, 29097873, 31186633		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22681645	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24289616, 29097873, 30361512, 37670384	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	25034653		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21515823	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	11739291		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	18759277	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	BEFREE	21440088		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17695432	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23792445, 29416802, 29912633, 30478786		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30478786	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10398839		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23183654, 26637476, 34048174	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19367286, 27402115, 31242951, 39224598	Associate	★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	19367286	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	31081293		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	15784727	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	21440088		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33512476	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	10701682	Associate	★☆☆☆☆ Found in Text Mining only