GZMM (granzyme M)

Gene

• Entrez ID: 3004
• Gene name: Granzyme M
• Gene symbol: GZMM
• Synonyms (NCBI Gene): LMET1, MET1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectivel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT490825	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT490823	hsa-miR-1914-5p	PAR-CLIP	20371350
MIRT490822	hsa-miR-7114-5p	PAR-CLIP	20371350
MIRT490821	hsa-miR-2277-3p	PAR-CLIP	20371350
MIRT490820	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT490818	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490819	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT490817	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT490825	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490823	hsa-miR-1914-5p	PAR-CLIP	23592263
MIRT490822	hsa-miR-7114-5p	PAR-CLIP	23592263
MIRT490821	hsa-miR-2277-3p	PAR-CLIP	23592263
MIRT490820	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT490818	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT490819	hsa-miR-615-5p	PAR-CLIP	23592263
MIRT490817	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT490825	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT490823	hsa-miR-1914-5p	PAR-CLIP	20371350
MIRT490822	hsa-miR-7114-5p	PAR-CLIP	20371350
MIRT490821	hsa-miR-2277-3p	PAR-CLIP	20371350
MIRT490820	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT490818	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490819	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT490817	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT490825	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT490823	hsa-miR-1914-5p	PAR-CLIP	23592263
MIRT490822	hsa-miR-7114-5p	PAR-CLIP	23592263
MIRT490821	hsa-miR-2277-3p	PAR-CLIP	23592263
MIRT490820	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT490818	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT490819	hsa-miR-615-5p	PAR-CLIP	23592263
MIRT490817	hsa-miR-7847-3p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IMP	21857942
GO:0005515	Function	Protein binding	IPI	21857942, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	21857942
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	7713495
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0051604	Process	Protein maturation	IBA

Other IDs

• MIM: 600311
• HGNC: 4712
• e!Ensembl: ENSG00000197540

Protein

• UniProt ID: P51124
• Protein name: Granzyme M (EC 3.4.21.-) (Met-1 serine protease) (Hu-Met-1) (Met-ase) (Natural killer cell granular protease)
• Protein function: Cleaves peptide substrates after methionine, leucine, and norleucine. Physiological substrates include EZR, alpha-tubulins and the apoptosis inhibitor BIRC5/Survivin. Promotes caspase activation and subsequent apoptosis of target cells. {ECO:000
• PDB: 2ZGC, 2ZGH, 2ZGJ, 2ZKS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00089	Trypsin	26 → 249	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly and constitutively expressed in activated natural killer (NK) cells. {ECO:0000269|PubMed:18523284}.
• Sequence:

  MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKW
  VLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGK
  VKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSR
  FWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVAT
  AVAPYVSWIRKVTGRSA

• Sequence length: 257

Pathways

Reactome:

Alternative complement activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	14559836, 23321252, 24890041		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29681102		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31172927	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23032187		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28659634		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28659634, 37277882	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28659634	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12939467		★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	30696914		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37158960	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37857563	Associate	★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	27431289		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31000415		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34518544	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	14559836		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27441655		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30690039	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14559836, 23321252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28659634		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28657667		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28657667, 29053955		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17123307, 19103589, 23047602, 24890041, 28657667		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34743649	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28657667		★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	29681102		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31172927		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17123307		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28977792	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	12506019		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	37158960	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27441655		★☆☆☆☆ Found in Text Mining only