Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	30010
Gene name	Neurexophilin 1
Gene symbol	NXPH1
Synonyms (NCBI Gene)	NPH1Nbla00697
Chromosome	7
Chromosome location	7p21.3
Summary	This gene is a member of the neurexophilin family and encodes a secreted protein with a variable N-terminal domain, a highly conserved, N-glycosylated central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein forms a very

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments
MIRT1200546	hsa-let-7a	CLIP-seq
MIRT1200547	hsa-let-7b	CLIP-seq
MIRT1200548	hsa-let-7c	CLIP-seq
MIRT1200549	hsa-let-7d	CLIP-seq
MIRT1200550	hsa-let-7e	CLIP-seq
MIRT1200551	hsa-let-7f	CLIP-seq
MIRT1200552	hsa-let-7g	CLIP-seq
MIRT1200553	hsa-let-7i	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200555	hsa-miR-1287	CLIP-seq
MIRT1200556	hsa-miR-1304	CLIP-seq
MIRT1200557	hsa-miR-1305	CLIP-seq
MIRT1200558	hsa-miR-146b-3p	CLIP-seq
MIRT1200559	hsa-miR-194	CLIP-seq
MIRT1200560	hsa-miR-202	CLIP-seq
MIRT1200561	hsa-miR-3065-5p	CLIP-seq
MIRT1200562	hsa-miR-3135b	CLIP-seq
MIRT1200563	hsa-miR-3148	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200565	hsa-miR-3194-3p	CLIP-seq
MIRT1200566	hsa-miR-323-3p	CLIP-seq
MIRT1200567	hsa-miR-339-5p	CLIP-seq
MIRT1200568	hsa-miR-3613-5p	CLIP-seq
MIRT1200569	hsa-miR-3924	CLIP-seq
MIRT1200570	hsa-miR-409-3p	CLIP-seq
MIRT1200571	hsa-miR-421	CLIP-seq
MIRT1200572	hsa-miR-4427	CLIP-seq
MIRT1200573	hsa-miR-4458	CLIP-seq
MIRT1200574	hsa-miR-4500	CLIP-seq
MIRT1200575	hsa-miR-4659a-3p	CLIP-seq
MIRT1200576	hsa-miR-4659b-3p	CLIP-seq
MIRT1200577	hsa-miR-4680-3p	CLIP-seq
MIRT1200578	hsa-miR-4728-3p	CLIP-seq
MIRT1200579	hsa-miR-4778-3p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200582	hsa-miR-568	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200584	hsa-miR-759	CLIP-seq
MIRT1200585	hsa-miR-875-3p	CLIP-seq
MIRT1200586	hsa-miR-98	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT2058022	hsa-miR-587	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT1200584	hsa-miR-759	CLIP-seq
MIRT1200546	hsa-let-7a	CLIP-seq
MIRT1200547	hsa-let-7b	CLIP-seq
MIRT1200548	hsa-let-7c	CLIP-seq
MIRT1200549	hsa-let-7d	CLIP-seq
MIRT1200550	hsa-let-7e	CLIP-seq
MIRT1200551	hsa-let-7f	CLIP-seq
MIRT1200552	hsa-let-7g	CLIP-seq
MIRT1200553	hsa-let-7i	CLIP-seq
MIRT2286411	hsa-miR-1248	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200556	hsa-miR-1304	CLIP-seq
MIRT1200559	hsa-miR-194	CLIP-seq
MIRT1200560	hsa-miR-202	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200573	hsa-miR-4458	CLIP-seq
MIRT1200574	hsa-miR-4500	CLIP-seq
MIRT1200575	hsa-miR-4659a-3p	CLIP-seq
MIRT1200576	hsa-miR-4659b-3p	CLIP-seq
MIRT1200579	hsa-miR-4778-3p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT2058022	hsa-miR-587	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT2286412	hsa-miR-642b	CLIP-seq
MIRT1200586	hsa-miR-98	CLIP-seq
MIRT1200554	hsa-miR-1285	CLIP-seq
MIRT1200564	hsa-miR-3187-5p	CLIP-seq
MIRT1200580	hsa-miR-499-3p	CLIP-seq
MIRT1200581	hsa-miR-499a-3p	CLIP-seq
MIRT1200583	hsa-miR-612	CLIP-seq
MIRT2584401	hsa-miR-338-5p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0043083	Component	Synaptic cleft	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA

MIM	HGNC	e!Ensembl
604639	20693	ENSG00000122584

P58417

Protein name

Neurexophilin-1

Protein function

May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06312	Neurexophilin	63 → 271	Neurexophilin	Family

Sequence

MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS
QTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFG
WGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQ
QTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICI
YISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Sequence length

271

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BINGE EATING	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXOSTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROIDITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	20100581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	22016809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22016809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	8995741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	10511339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24041540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28068899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	10511339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus, Normal Pressure	Hydrocephalus	BEFREE	7806215, 8995741, 9502560, 9587065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17601928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	24041540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	8825638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	8995741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	8995741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24041540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17601928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	10511339, 11096053, 12536190, 7806215, 8825638, 8995741, 9794556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	10511339, 7806215, 8697815, 8825638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis familial juvenile	Nephronophthisis	Pubtator	17601928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis, familial juvenile	Nephronophthisis	BEFREE	10511339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26646589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28068899		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	28068899	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19350199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NXPH1 (neurexophilin 1)