Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29988
Gene name	Solute carrier family 2 member 8
Gene symbol	SLC2A8
Synonyms (NCBI Gene)	GLUT8GLUTX1
Chromosome	9
Chromosome location	9q33.3
Summary	This gene belongs to the solute carrier 2A family, which includes intracellular glucose transporters. Based on sequence comparison, the glucose transporters are grouped into three classes and this gene is a member of class II. The encoded protein, like ot

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT722148	hsa-miR-4323	HITS-CLIP	19536157
MIRT722147	hsa-miR-3943	HITS-CLIP	19536157
MIRT722146	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT713584	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT713583	hsa-miR-4419a	HITS-CLIP	19536157
MIRT713582	hsa-miR-4510	HITS-CLIP	19536157
MIRT713581	hsa-miR-6127	HITS-CLIP	19536157
MIRT713580	hsa-miR-6129	HITS-CLIP	19536157
MIRT713579	hsa-miR-6130	HITS-CLIP	19536157
MIRT713578	hsa-miR-6133	HITS-CLIP	19536157
MIRT713577	hsa-miR-3135b	HITS-CLIP	19536157
MIRT713576	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT713574	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT713575	hsa-miR-3652	HITS-CLIP	19536157
MIRT713573	hsa-miR-4430	HITS-CLIP	19536157
MIRT713572	hsa-miR-4656	HITS-CLIP	19536157
MIRT713571	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT713570	hsa-miR-4492	HITS-CLIP	19536157
MIRT713569	hsa-miR-4498	HITS-CLIP	19536157
MIRT713568	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT713567	hsa-miR-762	HITS-CLIP	19536157
MIRT713566	hsa-miR-4675	HITS-CLIP	19536157
MIRT713565	hsa-miR-4741	HITS-CLIP	19536157
MIRT713564	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT713562	hsa-miR-1587	HITS-CLIP	19536157
MIRT713563	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT713584	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT713583	hsa-miR-4419a	HITS-CLIP	19536157
MIRT713582	hsa-miR-4510	HITS-CLIP	19536157
MIRT713581	hsa-miR-6127	HITS-CLIP	19536157
MIRT713580	hsa-miR-6129	HITS-CLIP	19536157
MIRT713579	hsa-miR-6130	HITS-CLIP	19536157
MIRT713578	hsa-miR-6133	HITS-CLIP	19536157
MIRT713577	hsa-miR-3135b	HITS-CLIP	19536157
MIRT713576	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT713574	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT713575	hsa-miR-3652	HITS-CLIP	19536157
MIRT713573	hsa-miR-4430	HITS-CLIP	19536157
MIRT713572	hsa-miR-4656	HITS-CLIP	19536157
MIRT713571	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT713570	hsa-miR-4492	HITS-CLIP	19536157
MIRT713569	hsa-miR-4498	HITS-CLIP	19536157
MIRT713568	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT713567	hsa-miR-762	HITS-CLIP	19536157
MIRT713566	hsa-miR-4675	HITS-CLIP	19536157
MIRT713565	hsa-miR-4741	HITS-CLIP	19536157
MIRT713564	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT713562	hsa-miR-1587	HITS-CLIP	19536157
MIRT713563	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT509085	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT509086	hsa-miR-548m	PAR-CLIP	23446348
MIRT509084	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509082	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT509083	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT509081	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT722148	hsa-miR-4323	HITS-CLIP	19536157
MIRT722147	hsa-miR-3943	HITS-CLIP	19536157
MIRT722146	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT713584	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT713583	hsa-miR-4419a	HITS-CLIP	19536157
MIRT713582	hsa-miR-4510	HITS-CLIP	19536157
MIRT713581	hsa-miR-6127	HITS-CLIP	19536157
MIRT713580	hsa-miR-6129	HITS-CLIP	19536157
MIRT713579	hsa-miR-6130	HITS-CLIP	19536157
MIRT713578	hsa-miR-6133	HITS-CLIP	19536157
MIRT713577	hsa-miR-3135b	HITS-CLIP	19536157
MIRT713576	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT713574	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT713575	hsa-miR-3652	HITS-CLIP	19536157
MIRT713573	hsa-miR-4430	HITS-CLIP	19536157
MIRT713572	hsa-miR-4656	HITS-CLIP	19536157
MIRT713571	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT713570	hsa-miR-4492	HITS-CLIP	19536157
MIRT713569	hsa-miR-4498	HITS-CLIP	19536157
MIRT713568	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT713567	hsa-miR-762	HITS-CLIP	19536157
MIRT713566	hsa-miR-4675	HITS-CLIP	19536157
MIRT713565	hsa-miR-4741	HITS-CLIP	19536157
MIRT713564	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT713562	hsa-miR-1587	HITS-CLIP	19536157
MIRT713563	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT713584	hsa-miR-5587-3p	HITS-CLIP	19536157
MIRT713583	hsa-miR-4419a	HITS-CLIP	19536157
MIRT713582	hsa-miR-4510	HITS-CLIP	19536157
MIRT713581	hsa-miR-6127	HITS-CLIP	19536157
MIRT713580	hsa-miR-6129	HITS-CLIP	19536157
MIRT713579	hsa-miR-6130	HITS-CLIP	19536157
MIRT713578	hsa-miR-6133	HITS-CLIP	19536157
MIRT713577	hsa-miR-3135b	HITS-CLIP	19536157
MIRT713576	hsa-miR-1249-5p	HITS-CLIP	19536157
MIRT713574	hsa-miR-6797-5p	HITS-CLIP	19536157
MIRT713575	hsa-miR-3652	HITS-CLIP	19536157
MIRT713573	hsa-miR-4430	HITS-CLIP	19536157
MIRT713572	hsa-miR-4656	HITS-CLIP	19536157
MIRT713571	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT713570	hsa-miR-4492	HITS-CLIP	19536157
MIRT713569	hsa-miR-4498	HITS-CLIP	19536157
MIRT713568	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT713567	hsa-miR-762	HITS-CLIP	19536157
MIRT713566	hsa-miR-4675	HITS-CLIP	19536157
MIRT713565	hsa-miR-4741	HITS-CLIP	19536157
MIRT713564	hsa-miR-6515-5p	HITS-CLIP	19536157
MIRT713562	hsa-miR-1587	HITS-CLIP	19536157
MIRT713563	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT509085	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT509086	hsa-miR-548m	PAR-CLIP	23446348
MIRT509084	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT509082	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT509083	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT509081	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT1359036	hsa-miR-1225-3p	CLIP-seq
MIRT1359037	hsa-miR-1233	CLIP-seq
MIRT1359038	hsa-miR-124	CLIP-seq
MIRT1359039	hsa-miR-1289	CLIP-seq
MIRT1359040	hsa-miR-1915	CLIP-seq
MIRT1359041	hsa-miR-3065-3p	CLIP-seq
MIRT1359042	hsa-miR-3174	CLIP-seq
MIRT1359043	hsa-miR-3198	CLIP-seq
MIRT1359044	hsa-miR-365	CLIP-seq
MIRT1359045	hsa-miR-3714	CLIP-seq
MIRT1359046	hsa-miR-3910	CLIP-seq
MIRT1359047	hsa-miR-4294	CLIP-seq
MIRT1359048	hsa-miR-4309	CLIP-seq
MIRT1359049	hsa-miR-432	CLIP-seq
MIRT1359050	hsa-miR-4438	CLIP-seq
MIRT1359051	hsa-miR-4453	CLIP-seq
MIRT1359052	hsa-miR-4471	CLIP-seq
MIRT1359053	hsa-miR-4538	CLIP-seq
MIRT1359054	hsa-miR-506	CLIP-seq
MIRT1359055	hsa-miR-513a-5p	CLIP-seq
MIRT1359056	hsa-miR-921	CLIP-seq
MIRT2106310	hsa-miR-1224-3p	CLIP-seq
MIRT2106311	hsa-miR-1236	CLIP-seq
MIRT1359038	hsa-miR-124	CLIP-seq
MIRT2106312	hsa-miR-1271	CLIP-seq
MIRT2106313	hsa-miR-15a	CLIP-seq
MIRT2106314	hsa-miR-15b	CLIP-seq
MIRT2106315	hsa-miR-16	CLIP-seq
MIRT2106316	hsa-miR-182	CLIP-seq
MIRT2106317	hsa-miR-195	CLIP-seq
MIRT2106318	hsa-miR-214	CLIP-seq
MIRT2106319	hsa-miR-223	CLIP-seq
MIRT2106320	hsa-miR-2278	CLIP-seq
MIRT2106321	hsa-miR-28-5p	CLIP-seq
MIRT2106322	hsa-miR-3139	CLIP-seq
MIRT2106323	hsa-miR-3619-5p	CLIP-seq
MIRT2106324	hsa-miR-3667-3p	CLIP-seq
MIRT1359045	hsa-miR-3714	CLIP-seq
MIRT1359046	hsa-miR-3910	CLIP-seq
MIRT2106325	hsa-miR-424	CLIP-seq
MIRT2106326	hsa-miR-4470	CLIP-seq
MIRT2106327	hsa-miR-4487	CLIP-seq
MIRT2106328	hsa-miR-4697-3p	CLIP-seq
MIRT2106329	hsa-miR-4722-5p	CLIP-seq
MIRT2106330	hsa-miR-497	CLIP-seq
MIRT1359054	hsa-miR-506	CLIP-seq
MIRT2106331	hsa-miR-513a-3p	CLIP-seq
MIRT2106332	hsa-miR-572	CLIP-seq
MIRT2106333	hsa-miR-622	CLIP-seq
MIRT2106334	hsa-miR-708	CLIP-seq
MIRT2106335	hsa-miR-761	CLIP-seq
MIRT2106336	hsa-miR-766	CLIP-seq
MIRT2106337	hsa-miR-96	CLIP-seq
MIRT1359038	hsa-miR-124	CLIP-seq
MIRT1359045	hsa-miR-3714	CLIP-seq
MIRT1359046	hsa-miR-3910	CLIP-seq
MIRT1359054	hsa-miR-506	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005353	Function	Fructose transmembrane transporter activity	IEA
GO:0005353	Function	Fructose transmembrane transporter activity	ISS
GO:0005536	Function	D-glucose binding	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10671487
GO:0005975	Process	Carbohydrate metabolic process	TAS	10671487
GO:0007141	Process	Male meiosis I	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015755	Process	Fructose transmembrane transport	IEA
GO:0015755	Process	Fructose transmembrane transport	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033300	Function	Dehydroascorbic acid transmembrane transporter activity	IEA
GO:0033300	Function	Dehydroascorbic acid transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS	10671487
GO:0055085	Process	Transmembrane transport	IEA
GO:0070837	Process	Dehydroascorbic acid transport	IEA
GO:0070837	Process	Dehydroascorbic acid transport	ISS
GO:1904659	Process	D-glucose transmembrane transport	IBA
GO:1904659	Process	D-glucose transmembrane transport	IEA
GO:1904659	Process	D-glucose transmembrane transport	ISS
GO:1904659	Process	D-glucose transmembrane transport	TAS	10671487

MIM	HGNC	e!Ensembl
605245	13812	ENSG00000136856

Q9NY64

Protein name

Solute carrier family 2, facilitated glucose transporter member 8 (Glucose transporter type 8) (GLUT-8) (Glucose transporter type X1)

Protein function

Insulin-regulated facilitative hexose transporter that mediates the transport of glucose and fructose (By similarity). Facilitates hepatic influx of dietary trehalose, which in turn inhibits glucose and fructose influx triggering a starvation si

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	29 → 474	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, but not in testicular carcinoma. Lower amounts present in most other tissues. {ECO:0000269|PubMed:10821868}.

Sequence

MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPP
APRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDV
WMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLE
WRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAE
QSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV
IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVS
AQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLM
AFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR

Sequence length

477

Interactions

View interactions

	Reactome
			Cellular hexose transport Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Dementia	Dementia	Pubtator	35299244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28034463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31676315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16892013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28471544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29590129	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22452979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22452979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19554504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24519932		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC2A8 (solute carrier family 2 member 8)