Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29985
Gene name	Solute carrier family 39 member 3
Gene symbol	SLC39A3
Synonyms (NCBI Gene)	ZIP-3ZIP3
Chromosome	19
Chromosome location	19p13.3

Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023150	hsa-miR-124-3p	Microarray	18668037
MIRT024059	hsa-miR-1-3p	Microarray	18668037
MIRT1363495	hsa-miR-1538	CLIP-seq
MIRT1363496	hsa-miR-3657	CLIP-seq
MIRT1363497	hsa-miR-4283	CLIP-seq
MIRT1363498	hsa-miR-4508	CLIP-seq
MIRT1363499	hsa-miR-4532	CLIP-seq
MIRT1363500	hsa-miR-4669	CLIP-seq
MIRT1363501	hsa-miR-4745-3p	CLIP-seq
MIRT1363502	hsa-miR-134	CLIP-seq
MIRT1363503	hsa-miR-2467-3p	CLIP-seq
MIRT1363504	hsa-miR-3118	CLIP-seq
MIRT1363505	hsa-miR-3164	CLIP-seq
MIRT1363506	hsa-miR-3202	CLIP-seq
MIRT1363507	hsa-miR-3663-3p	CLIP-seq
MIRT1363508	hsa-miR-4271	CLIP-seq
MIRT1363509	hsa-miR-4504	CLIP-seq
MIRT1363510	hsa-miR-4690-3p	CLIP-seq
MIRT1363511	hsa-miR-4725-3p	CLIP-seq
MIRT1363512	hsa-miR-4747-5p	CLIP-seq
MIRT1363513	hsa-miR-4768-3p	CLIP-seq
MIRT1363514	hsa-miR-486-3p	CLIP-seq
MIRT1363515	hsa-miR-549	CLIP-seq
MIRT1363516	hsa-miR-665	CLIP-seq
MIRT2107831	hsa-miR-1253	CLIP-seq
MIRT2107832	hsa-miR-223	CLIP-seq
MIRT2107833	hsa-miR-329	CLIP-seq
MIRT2107834	hsa-miR-362-3p	CLIP-seq
MIRT2107835	hsa-miR-377	CLIP-seq
MIRT2107836	hsa-miR-412	CLIP-seq
MIRT2107837	hsa-miR-4252	CLIP-seq
MIRT2107838	hsa-miR-4434	CLIP-seq
MIRT2107839	hsa-miR-4493	CLIP-seq
MIRT2107840	hsa-miR-4516	CLIP-seq
MIRT2107841	hsa-miR-4659a-5p	CLIP-seq
MIRT2107842	hsa-miR-4659b-5p	CLIP-seq
MIRT2107843	hsa-miR-4697-3p	CLIP-seq
MIRT2107844	hsa-miR-4717-5p	CLIP-seq
MIRT2107845	hsa-miR-4753-5p	CLIP-seq
MIRT2107846	hsa-miR-4764-3p	CLIP-seq
MIRT2107847	hsa-miR-4786-3p	CLIP-seq
MIRT2107848	hsa-miR-622	CLIP-seq
MIRT2331630	hsa-miR-1322	CLIP-seq
MIRT2331631	hsa-miR-1913	CLIP-seq
MIRT2331632	hsa-miR-214	CLIP-seq
MIRT1363503	hsa-miR-2467-3p	CLIP-seq
MIRT2331633	hsa-miR-3120-3p	CLIP-seq
MIRT2331634	hsa-miR-3138	CLIP-seq
MIRT2331635	hsa-miR-3189-5p	CLIP-seq
MIRT2331636	hsa-miR-324-3p	CLIP-seq
MIRT2331637	hsa-miR-3605-5p	CLIP-seq
MIRT2331638	hsa-miR-3619-5p	CLIP-seq
MIRT2107835	hsa-miR-377	CLIP-seq
MIRT2331639	hsa-miR-4291	CLIP-seq
MIRT2331640	hsa-miR-4433	CLIP-seq
MIRT2331641	hsa-miR-4459	CLIP-seq
MIRT2331642	hsa-miR-4758-3p	CLIP-seq
MIRT1363513	hsa-miR-4768-3p	CLIP-seq
MIRT2331643	hsa-miR-545	CLIP-seq
MIRT2331644	hsa-miR-571	CLIP-seq
MIRT2331645	hsa-miR-626	CLIP-seq
MIRT2331646	hsa-miR-761	CLIP-seq
MIRT2331647	hsa-miR-922	CLIP-seq
MIRT2394781	hsa-miR-10a	CLIP-seq
MIRT2394782	hsa-miR-10b	CLIP-seq
MIRT2394783	hsa-miR-339-5p	CLIP-seq
MIRT2459754	hsa-miR-4707-5p	CLIP-seq
MIRT2459755	hsa-miR-551a	CLIP-seq
MIRT2459756	hsa-miR-551b	CLIP-seq
MIRT2459757	hsa-miR-877	CLIP-seq
MIRT2626187	hsa-miR-1273f	CLIP-seq
MIRT2626188	hsa-miR-143	CLIP-seq
MIRT2626189	hsa-miR-1915	CLIP-seq
MIRT2626190	hsa-miR-3682-3p	CLIP-seq
MIRT2626191	hsa-miR-4677-3p	CLIP-seq
MIRT2626192	hsa-miR-4708-5p	CLIP-seq
MIRT2626193	hsa-miR-4738-3p	CLIP-seq
MIRT2626194	hsa-miR-4770	CLIP-seq
MIRT2626195	hsa-miR-548g	CLIP-seq
MIRT2626189	hsa-miR-1915	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RREB1	Unknown	21613827

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	ISS
GO:0005385	Function	Zinc ion transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060173	Process	Limb development	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0071577	Process	Zinc ion transmembrane transport	ISS
GO:0071577	Process	Zinc ion transmembrane transport	TAS
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	ISS

MIM	HGNC	e!Ensembl
612168	17128	ENSG00000141873

Q9BRY0

Protein name

Zinc transporter ZIP3 (Solute carrier family 39 member 3) (Zrt- and Irt-like protein 3) (ZIP-3)

Protein function

Transporter for the divalent cation Zn(2+). Mediates the influx of Zn(2+) into cells from extracellular space. Controls Zn(2+) accumulation into dentate gyrus granule cells in the hippocampus. Mediates Zn(2+) reuptake from the secreted milk with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02535	Zip	5 → 310	ZIP Zinc transporter	Family

Sequence

MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF
NALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLET
FNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH
SVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMI
PLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV
LGYTVLAGMVFLKW

Sequence length

314

Interactions

View interactions

	KEGG		Reactome
	Alzheimer disease Parkinson disease		Zinc influx into cells by the SLC39 gene family

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	21613827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21613827, 25050557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	27063557	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	32744318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25050557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33535184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	21478106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	21478106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25156968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23595627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21613827, 25050557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21613827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21613827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21613827, 25050557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21613827, 22427155, 25050557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21940908	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	22078303		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SLC39A3 (solute carrier family 39 member 3)