UBQLN1 (ubiquilin 1)

Gene

• Entrez ID: 29979
• Gene name: Ubiquilin 1
• Gene symbol: UBQLN1
• Synonyms (NCBI Gene): DA41, DSK2, PLIC-1, UBQN, XDRP1
• Chromosome: 9
• Chromosome location: 9q21.32|9q21.2-q21.3
• Summary: This gene encodes an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physica

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1060499753	T>-	Likely-pathogenic, uncertain-significance	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003156	hsa-miR-210-3p	immunoprecipitaion, Microarray, qRT-PCR	19826008
MIRT020996	hsa-miR-155-5p	Proteomics	18668040
MIRT020996	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT048505	hsa-miR-100-5p	CLASH	23622248
MIRT048505	hsa-miR-100-5p	CLASH	23622248
MIRT043312	hsa-miR-331-3p	CLASH	23622248
MIRT043312	hsa-miR-331-3p	CLASH	23622248
MIRT043312	hsa-miR-331-3p	CLASH	23622248
MIRT042191	hsa-miR-484	CLASH	23622248
MIRT042191	hsa-miR-484	CLASH	23622248
MIRT438528	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay	25044403
MIRT438528	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay	25044403
MIRT438528	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay	25044403
MIRT438528	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay	25044403
MIRT697828	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT697827	hsa-miR-4662a-3p	HITS-CLIP	23313552
MIRT697826	hsa-miR-577	HITS-CLIP	23313552
MIRT697825	hsa-miR-3168	HITS-CLIP	23313552
MIRT697824	hsa-miR-148b-5p	HITS-CLIP	23313552
MIRT697823	hsa-miR-6874-3p	HITS-CLIP	23313552
MIRT697822	hsa-miR-5584-3p	HITS-CLIP	23313552
MIRT697821	hsa-miR-1914-5p	HITS-CLIP	23313552
MIRT697820	hsa-miR-570-3p	HITS-CLIP	23313552
MIRT697819	hsa-miR-539-5p	HITS-CLIP	23313552
MIRT697818	hsa-miR-6076	HITS-CLIP	23313552
MIRT697817	hsa-miR-6797-3p	HITS-CLIP	23313552
MIRT697816	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT697815	hsa-miR-6894-3p	HITS-CLIP	23313552
MIRT697814	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT697813	hsa-miR-4482-3p	HITS-CLIP	23313552
MIRT439353	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT394127	hsa-miR-544a	HITS-CLIP	24374217
MIRT439353	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT394127	hsa-miR-544a	HITS-CLIP	24374217
MIRT697828	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT697827	hsa-miR-4662a-3p	HITS-CLIP	23313552
MIRT697826	hsa-miR-577	HITS-CLIP	23313552
MIRT697825	hsa-miR-3168	HITS-CLIP	23313552
MIRT697824	hsa-miR-148b-5p	HITS-CLIP	23313552
MIRT697823	hsa-miR-6874-3p	HITS-CLIP	23313552
MIRT697822	hsa-miR-5584-3p	HITS-CLIP	23313552
MIRT697821	hsa-miR-1914-5p	HITS-CLIP	23313552
MIRT697820	hsa-miR-570-3p	HITS-CLIP	23313552
MIRT697819	hsa-miR-539-5p	HITS-CLIP	23313552
MIRT697818	hsa-miR-6076	HITS-CLIP	23313552
MIRT697817	hsa-miR-6797-3p	HITS-CLIP	23313552
MIRT697816	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT697815	hsa-miR-6894-3p	HITS-CLIP	23313552
MIRT697814	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT697813	hsa-miR-4482-3p	HITS-CLIP	23313552
MIRT1470801	hsa-miR-3163	CLIP-seq
MIRT1470802	hsa-miR-338-5p	CLIP-seq
MIRT1470803	hsa-miR-3663-5p	CLIP-seq
MIRT1470804	hsa-miR-4307	CLIP-seq
MIRT1470805	hsa-miR-1	CLIP-seq
MIRT1470806	hsa-miR-105	CLIP-seq
MIRT1470807	hsa-miR-1178	CLIP-seq
MIRT1470808	hsa-miR-1183	CLIP-seq
MIRT1470809	hsa-miR-1202	CLIP-seq
MIRT1470810	hsa-miR-1208	CLIP-seq
MIRT1470811	hsa-miR-1253	CLIP-seq
MIRT1470812	hsa-miR-1257	CLIP-seq
MIRT1470813	hsa-miR-1260	CLIP-seq
MIRT1470814	hsa-miR-1260b	CLIP-seq
MIRT1470815	hsa-miR-1279	CLIP-seq
MIRT1470816	hsa-miR-1284	CLIP-seq
MIRT1470817	hsa-miR-130a	CLIP-seq
MIRT1470818	hsa-miR-130b	CLIP-seq
MIRT1470819	hsa-miR-133a	CLIP-seq
MIRT1470820	hsa-miR-133b	CLIP-seq
MIRT1470821	hsa-miR-140-3p	CLIP-seq
MIRT1470822	hsa-miR-154	CLIP-seq
MIRT1470823	hsa-miR-155	CLIP-seq
MIRT1470824	hsa-miR-188-3p	CLIP-seq
MIRT1470825	hsa-miR-1913	CLIP-seq
MIRT1470826	hsa-miR-19a	CLIP-seq
MIRT1470827	hsa-miR-19b	CLIP-seq
MIRT1470828	hsa-miR-200b	CLIP-seq
MIRT1470829	hsa-miR-200c	CLIP-seq
MIRT1470830	hsa-miR-204	CLIP-seq
MIRT1470831	hsa-miR-205	CLIP-seq
MIRT1470832	hsa-miR-2052	CLIP-seq
MIRT1470833	hsa-miR-206	CLIP-seq
MIRT1470834	hsa-miR-211	CLIP-seq
MIRT1470835	hsa-miR-224	CLIP-seq
MIRT1470836	hsa-miR-24	CLIP-seq
MIRT1470837	hsa-miR-25	CLIP-seq
MIRT1470838	hsa-miR-298	CLIP-seq
MIRT1470839	hsa-miR-301a	CLIP-seq
MIRT1470840	hsa-miR-301b	CLIP-seq
MIRT1470841	hsa-miR-3122	CLIP-seq
MIRT1470842	hsa-miR-3130-3p	CLIP-seq
MIRT1470843	hsa-miR-3145-5p	CLIP-seq
MIRT1470844	hsa-miR-3156-3p	CLIP-seq
MIRT1470845	hsa-miR-3157-5p	CLIP-seq
MIRT1470846	hsa-miR-3180-5p	CLIP-seq
MIRT1470847	hsa-miR-3189-5p	CLIP-seq
MIRT1470848	hsa-miR-32	CLIP-seq
MIRT1470849	hsa-miR-320e	CLIP-seq
MIRT1470850	hsa-miR-323-3p	CLIP-seq
MIRT1470851	hsa-miR-324-3p	CLIP-seq
MIRT1470802	hsa-miR-338-5p	CLIP-seq
MIRT1470852	hsa-miR-3614-3p	CLIP-seq
MIRT1470853	hsa-miR-363	CLIP-seq
MIRT1470854	hsa-miR-3646	CLIP-seq
MIRT1470855	hsa-miR-365	CLIP-seq
MIRT1470856	hsa-miR-3662	CLIP-seq
MIRT1470857	hsa-miR-3666	CLIP-seq
MIRT1470858	hsa-miR-367	CLIP-seq
MIRT1470859	hsa-miR-3672	CLIP-seq
MIRT1470860	hsa-miR-3689a-3p	CLIP-seq
MIRT1470861	hsa-miR-3689c	CLIP-seq
MIRT1470862	hsa-miR-3913-5p	CLIP-seq
MIRT1470863	hsa-miR-3919	CLIP-seq
MIRT1470864	hsa-miR-3934	CLIP-seq
MIRT1470865	hsa-miR-3940-5p	CLIP-seq
MIRT1470866	hsa-miR-3942-5p	CLIP-seq
MIRT1470867	hsa-miR-3972	CLIP-seq
MIRT1470868	hsa-miR-3976	CLIP-seq
MIRT1470869	hsa-miR-3977	CLIP-seq
MIRT1470870	hsa-miR-409-3p	CLIP-seq
MIRT1470871	hsa-miR-412	CLIP-seq
MIRT1470872	hsa-miR-4251	CLIP-seq
MIRT1470873	hsa-miR-4284	CLIP-seq
MIRT1470874	hsa-miR-429	CLIP-seq
MIRT1470875	hsa-miR-4295	CLIP-seq
MIRT1470876	hsa-miR-4301	CLIP-seq
MIRT1470804	hsa-miR-4307	CLIP-seq
MIRT1470877	hsa-miR-4325	CLIP-seq
MIRT1470878	hsa-miR-4326	CLIP-seq
MIRT1470879	hsa-miR-4423-3p	CLIP-seq
MIRT1470880	hsa-miR-4427	CLIP-seq
MIRT1470881	hsa-miR-4434	CLIP-seq
MIRT1470882	hsa-miR-4436a	CLIP-seq
MIRT1470883	hsa-miR-4446-5p	CLIP-seq
MIRT1470884	hsa-miR-4452	CLIP-seq
MIRT1470885	hsa-miR-4470	CLIP-seq
MIRT1470886	hsa-miR-4503	CLIP-seq
MIRT1470887	hsa-miR-4507	CLIP-seq
MIRT1470888	hsa-miR-4509	CLIP-seq
MIRT1470889	hsa-miR-4516	CLIP-seq
MIRT1470890	hsa-miR-451b	CLIP-seq
MIRT1470891	hsa-miR-4527	CLIP-seq
MIRT1470892	hsa-miR-454	CLIP-seq
MIRT1470893	hsa-miR-4653-3p	CLIP-seq
MIRT1470894	hsa-miR-4677-3p	CLIP-seq
MIRT1470895	hsa-miR-4679	CLIP-seq
MIRT1470896	hsa-miR-4680-3p	CLIP-seq
MIRT1470897	hsa-miR-4691-3p	CLIP-seq
MIRT1470898	hsa-miR-4693-5p	CLIP-seq
MIRT1470899	hsa-miR-4698	CLIP-seq
MIRT1470900	hsa-miR-4703-5p	CLIP-seq
MIRT1470901	hsa-miR-4709-5p	CLIP-seq
MIRT1470902	hsa-miR-4711-5p	CLIP-seq
MIRT1470903	hsa-miR-4718	CLIP-seq
MIRT1470904	hsa-miR-4719	CLIP-seq
MIRT1470905	hsa-miR-4724-5p	CLIP-seq
MIRT1470906	hsa-miR-4755-5p	CLIP-seq
MIRT1470907	hsa-miR-4756-3p	CLIP-seq
MIRT1470908	hsa-miR-4758-3p	CLIP-seq
MIRT1470909	hsa-miR-4760-3p	CLIP-seq
MIRT1470910	hsa-miR-4780	CLIP-seq
MIRT1470911	hsa-miR-4793-3p	CLIP-seq
MIRT1470912	hsa-miR-4795-3p	CLIP-seq
MIRT1470913	hsa-miR-501-3p	CLIP-seq
MIRT1470914	hsa-miR-502-3p	CLIP-seq
MIRT1470915	hsa-miR-508-5p	CLIP-seq
MIRT1470916	hsa-miR-5095	CLIP-seq
MIRT1470917	hsa-miR-513a-3p	CLIP-seq
MIRT1470918	hsa-miR-520a-5p	CLIP-seq
MIRT1470919	hsa-miR-525-5p	CLIP-seq
MIRT1470920	hsa-miR-548ac	CLIP-seq
MIRT1470921	hsa-miR-548ag	CLIP-seq
MIRT1470922	hsa-miR-548ai	CLIP-seq
MIRT1470923	hsa-miR-548d-3p	CLIP-seq
MIRT1470924	hsa-miR-548z	CLIP-seq
MIRT1470925	hsa-miR-550b	CLIP-seq
MIRT1470926	hsa-miR-552	CLIP-seq
MIRT1470927	hsa-miR-567	CLIP-seq
MIRT1470928	hsa-miR-568	CLIP-seq
MIRT1470929	hsa-miR-572	CLIP-seq
MIRT1470930	hsa-miR-579	CLIP-seq
MIRT1470931	hsa-miR-582-5p	CLIP-seq
MIRT1470932	hsa-miR-590-3p	CLIP-seq
MIRT1470933	hsa-miR-599	CLIP-seq
MIRT1470934	hsa-miR-613	CLIP-seq
MIRT1470935	hsa-miR-622	CLIP-seq
MIRT1470936	hsa-miR-623	CLIP-seq
MIRT1470937	hsa-miR-629	CLIP-seq
MIRT1470938	hsa-miR-633	CLIP-seq
MIRT1470939	hsa-miR-643	CLIP-seq
MIRT1470940	hsa-miR-664	CLIP-seq
MIRT1470941	hsa-miR-665	CLIP-seq
MIRT1470942	hsa-miR-92a	CLIP-seq
MIRT1470943	hsa-miR-92b	CLIP-seq
MIRT2141728	hsa-miR-1238	CLIP-seq
MIRT1470812	hsa-miR-1257	CLIP-seq
MIRT1470815	hsa-miR-1279	CLIP-seq
MIRT1470816	hsa-miR-1284	CLIP-seq
MIRT1470817	hsa-miR-130a	CLIP-seq
MIRT1470818	hsa-miR-130b	CLIP-seq
MIRT2141729	hsa-miR-1343	CLIP-seq
MIRT2141730	hsa-miR-139-5p	CLIP-seq
MIRT2141731	hsa-miR-148a	CLIP-seq
MIRT2141732	hsa-miR-148b	CLIP-seq
MIRT2141733	hsa-miR-152	CLIP-seq
MIRT1470828	hsa-miR-200b	CLIP-seq
MIRT1470829	hsa-miR-200c	CLIP-seq
MIRT1470830	hsa-miR-204	CLIP-seq
MIRT1470831	hsa-miR-205	CLIP-seq
MIRT1470834	hsa-miR-211	CLIP-seq
MIRT2141734	hsa-miR-2110	CLIP-seq
MIRT2141735	hsa-miR-300	CLIP-seq
MIRT1470839	hsa-miR-301a	CLIP-seq
MIRT1470840	hsa-miR-301b	CLIP-seq
MIRT2141736	hsa-miR-3074-5p	CLIP-seq
MIRT1470841	hsa-miR-3122	CLIP-seq
MIRT1470842	hsa-miR-3130-3p	CLIP-seq
MIRT2141737	hsa-miR-3153	CLIP-seq
MIRT2141738	hsa-miR-3169	CLIP-seq
MIRT1470847	hsa-miR-3189-5p	CLIP-seq
MIRT2141739	hsa-miR-3192	CLIP-seq
MIRT2141740	hsa-miR-34c-3p	CLIP-seq
MIRT1470857	hsa-miR-3666	CLIP-seq
MIRT1470859	hsa-miR-3672	CLIP-seq
MIRT1470860	hsa-miR-3689a-3p	CLIP-seq
MIRT1470861	hsa-miR-3689c	CLIP-seq
MIRT2141741	hsa-miR-381	CLIP-seq
MIRT1470862	hsa-miR-3913-5p	CLIP-seq
MIRT1470870	hsa-miR-409-3p	CLIP-seq
MIRT2141742	hsa-miR-4255	CLIP-seq
MIRT2141743	hsa-miR-4271	CLIP-seq
MIRT1470874	hsa-miR-429	CLIP-seq
MIRT1470875	hsa-miR-4295	CLIP-seq
MIRT1470878	hsa-miR-4326	CLIP-seq
MIRT2141744	hsa-miR-4422	CLIP-seq
MIRT1470879	hsa-miR-4423-3p	CLIP-seq
MIRT1470880	hsa-miR-4427	CLIP-seq
MIRT1470882	hsa-miR-4436a	CLIP-seq
MIRT1470883	hsa-miR-4446-5p	CLIP-seq
MIRT1470884	hsa-miR-4452	CLIP-seq
MIRT2141745	hsa-miR-4456	CLIP-seq
MIRT1470885	hsa-miR-4470	CLIP-seq
MIRT1470888	hsa-miR-4509	CLIP-seq
MIRT2141746	hsa-miR-4515	CLIP-seq
MIRT1470891	hsa-miR-4527	CLIP-seq
MIRT1470892	hsa-miR-454	CLIP-seq
MIRT1470893	hsa-miR-4653-3p	CLIP-seq
MIRT2141747	hsa-miR-4666-3p	CLIP-seq
MIRT2141748	hsa-miR-4667-5p	CLIP-seq
MIRT1470894	hsa-miR-4677-3p	CLIP-seq
MIRT2141749	hsa-miR-4678	CLIP-seq
MIRT1470895	hsa-miR-4679	CLIP-seq
MIRT1470896	hsa-miR-4680-3p	CLIP-seq
MIRT2141750	hsa-miR-4691-5p	CLIP-seq
MIRT2141751	hsa-miR-4700-5p	CLIP-seq
MIRT2141752	hsa-miR-4708-3p	CLIP-seq
MIRT1470903	hsa-miR-4718	CLIP-seq
MIRT2141753	hsa-miR-4725-3p	CLIP-seq
MIRT2141754	hsa-miR-4731-5p	CLIP-seq
MIRT1470906	hsa-miR-4755-5p	CLIP-seq
MIRT1470908	hsa-miR-4758-3p	CLIP-seq
MIRT1470909	hsa-miR-4760-3p	CLIP-seq
MIRT2141755	hsa-miR-4773	CLIP-seq
MIRT2141756	hsa-miR-4775	CLIP-seq
MIRT1470910	hsa-miR-4780	CLIP-seq
MIRT1470911	hsa-miR-4793-3p	CLIP-seq
MIRT2141757	hsa-miR-541	CLIP-seq
MIRT1470921	hsa-miR-548ag	CLIP-seq
MIRT1470922	hsa-miR-548ai	CLIP-seq
MIRT2141758	hsa-miR-561	CLIP-seq
MIRT1470930	hsa-miR-579	CLIP-seq
MIRT1470931	hsa-miR-582-5p	CLIP-seq
MIRT1470935	hsa-miR-622	CLIP-seq
MIRT1470936	hsa-miR-623	CLIP-seq
MIRT2141759	hsa-miR-654-5p	CLIP-seq
MIRT1470940	hsa-miR-664	CLIP-seq
MIRT1470941	hsa-miR-665	CLIP-seq
MIRT1470828	hsa-miR-200b	CLIP-seq
MIRT1470829	hsa-miR-200c	CLIP-seq
MIRT2141740	hsa-miR-34c-3p	CLIP-seq
MIRT1470874	hsa-miR-429	CLIP-seq
MIRT1470806	hsa-miR-105	CLIP-seq
MIRT1470808	hsa-miR-1183	CLIP-seq
MIRT2141730	hsa-miR-139-5p	CLIP-seq
MIRT1470828	hsa-miR-200b	CLIP-seq
MIRT1470829	hsa-miR-200c	CLIP-seq
MIRT1470831	hsa-miR-205	CLIP-seq
MIRT1470843	hsa-miR-3145-5p	CLIP-seq
MIRT2362431	hsa-miR-3170	CLIP-seq
MIRT2141739	hsa-miR-3192	CLIP-seq
MIRT2141740	hsa-miR-34c-3p	CLIP-seq
MIRT2141742	hsa-miR-4255	CLIP-seq
MIRT2362432	hsa-miR-4260	CLIP-seq
MIRT1470874	hsa-miR-429	CLIP-seq
MIRT1470804	hsa-miR-4307	CLIP-seq
MIRT1470877	hsa-miR-4325	CLIP-seq
MIRT1470878	hsa-miR-4326	CLIP-seq
MIRT1470898	hsa-miR-4693-5p	CLIP-seq
MIRT2141754	hsa-miR-4731-5p	CLIP-seq
MIRT1470915	hsa-miR-508-5p	CLIP-seq
MIRT1470925	hsa-miR-550b	CLIP-seq
MIRT1470935	hsa-miR-622	CLIP-seq
MIRT1470816	hsa-miR-1284	CLIP-seq
MIRT1470828	hsa-miR-200b	CLIP-seq
MIRT1470829	hsa-miR-200c	CLIP-seq
MIRT1470843	hsa-miR-3145-5p	CLIP-seq
MIRT2141739	hsa-miR-3192	CLIP-seq
MIRT2362432	hsa-miR-4260	CLIP-seq
MIRT1470874	hsa-miR-429	CLIP-seq
MIRT1470903	hsa-miR-4718	CLIP-seq
MIRT2141754	hsa-miR-4731-5p	CLIP-seq
MIRT1470915	hsa-miR-508-5p	CLIP-seq
MIRT1470823	hsa-miR-155	CLIP-seq
MIRT2434434	hsa-miR-3140-3p	CLIP-seq
MIRT1470805	hsa-miR-1	CLIP-seq
MIRT1470809	hsa-miR-1202	CLIP-seq
MIRT2656315	hsa-miR-1248	CLIP-seq
MIRT2656316	hsa-miR-1275	CLIP-seq
MIRT2656317	hsa-miR-1276	CLIP-seq
MIRT1470819	hsa-miR-133a	CLIP-seq
MIRT1470820	hsa-miR-133b	CLIP-seq
MIRT2656318	hsa-miR-1827	CLIP-seq
MIRT1470824	hsa-miR-188-3p	CLIP-seq
MIRT1470833	hsa-miR-206	CLIP-seq
MIRT2656319	hsa-miR-216b	CLIP-seq
MIRT2656320	hsa-miR-3117-5p	CLIP-seq
MIRT1470841	hsa-miR-3122	CLIP-seq
MIRT1470801	hsa-miR-3163	CLIP-seq
MIRT1470860	hsa-miR-3689a-3p	CLIP-seq
MIRT1470861	hsa-miR-3689c	CLIP-seq
MIRT1470862	hsa-miR-3913-5p	CLIP-seq
MIRT1470867	hsa-miR-3972	CLIP-seq
MIRT2362432	hsa-miR-4260	CLIP-seq
MIRT2656321	hsa-miR-4275	CLIP-seq
MIRT1470804	hsa-miR-4307	CLIP-seq
MIRT2141744	hsa-miR-4422	CLIP-seq
MIRT1470879	hsa-miR-4423-3p	CLIP-seq
MIRT1470880	hsa-miR-4427	CLIP-seq
MIRT1470885	hsa-miR-4470	CLIP-seq
MIRT1470888	hsa-miR-4509	CLIP-seq
MIRT2656322	hsa-miR-4525	CLIP-seq
MIRT2656323	hsa-miR-4643	CLIP-seq
MIRT2656324	hsa-miR-4649-3p	CLIP-seq
MIRT1470893	hsa-miR-4653-3p	CLIP-seq
MIRT2656325	hsa-miR-4665-5p	CLIP-seq
MIRT1470901	hsa-miR-4709-5p	CLIP-seq
MIRT2656326	hsa-miR-4712-5p	CLIP-seq
MIRT2656327	hsa-miR-4723-5p	CLIP-seq
MIRT2656328	hsa-miR-4725-5p	CLIP-seq
MIRT2656329	hsa-miR-4728-5p	CLIP-seq
MIRT2656330	hsa-miR-4733-5p	CLIP-seq
MIRT2656331	hsa-miR-4776-3p	CLIP-seq
MIRT2656332	hsa-miR-504	CLIP-seq
MIRT1470934	hsa-miR-613	CLIP-seq
MIRT2656333	hsa-miR-625	CLIP-seq
MIRT2656334	hsa-miR-642b	CLIP-seq
MIRT2656335	hsa-miR-770-5p	CLIP-seq
MIRT2656336	hsa-miR-9	CLIP-seq
MIRT1470805	hsa-miR-1	CLIP-seq
MIRT1470809	hsa-miR-1202	CLIP-seq
MIRT2656315	hsa-miR-1248	CLIP-seq
MIRT2656317	hsa-miR-1276	CLIP-seq
MIRT1470819	hsa-miR-133a	CLIP-seq
MIRT1470820	hsa-miR-133b	CLIP-seq
MIRT2656318	hsa-miR-1827	CLIP-seq
MIRT1470824	hsa-miR-188-3p	CLIP-seq
MIRT1470833	hsa-miR-206	CLIP-seq
MIRT2656320	hsa-miR-3117-5p	CLIP-seq
MIRT1470867	hsa-miR-3972	CLIP-seq
MIRT2656321	hsa-miR-4275	CLIP-seq
MIRT1470804	hsa-miR-4307	CLIP-seq
MIRT2141744	hsa-miR-4422	CLIP-seq
MIRT1470880	hsa-miR-4427	CLIP-seq
MIRT1470888	hsa-miR-4509	CLIP-seq
MIRT2656323	hsa-miR-4643	CLIP-seq
MIRT2656324	hsa-miR-4649-3p	CLIP-seq
MIRT1470901	hsa-miR-4709-5p	CLIP-seq
MIRT2656326	hsa-miR-4712-5p	CLIP-seq
MIRT2656328	hsa-miR-4725-5p	CLIP-seq
MIRT2656330	hsa-miR-4733-5p	CLIP-seq
MIRT2656331	hsa-miR-4776-3p	CLIP-seq
MIRT2656332	hsa-miR-504	CLIP-seq
MIRT1470934	hsa-miR-613	CLIP-seq
MIRT2656334	hsa-miR-642b	CLIP-seq
MIRT2656335	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IMP	20529957
GO:0000502	Component	Proteasome complex	IEA
GO:0005515	Function	Protein binding	IPI	11076969, 12095988, 15147878, 16159959, 16189514, 16713569, 17082820, 18199683, 18307982, 19822669, 20059542, 21143716, 21516116, 21988832, 22233804, 23307288, 23459205, 25416956, 25910212, 26871637, 29892012, 31515488, 32296183, 32814053, 33961781, 35914814, 36217029
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11853878, 16159959
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	12634373
GO:0005776	Component	Autophagosome	IBA
GO:0005776	Component	Autophagosome	IDA	20529957, 21143716, 23307288, 23459205
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	12095988, 19822669
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	21143716
GO:0005886	Component	Plasma membrane	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006914	Process	Autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016235	Component	Aggresome	IDA	16159959, 21143716
GO:0016236	Process	Macroautophagy	IMP	20529957
GO:0016241	Process	Regulation of macroautophagy	IBA
GO:0019900	Function	Kinase binding	IPI	11853878
GO:0031396	Process	Regulation of protein ubiquitination	IDA	12634373
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	23307288
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	15147878
GO:0032991	Component	Protein-containing complex	IDA
GO:0034140	Process	Negative regulation of toll-like receptor 3 signaling pathway	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	12095988
GO:0035973	Process	Aggrephagy	IDA	21143716
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IEA
GO:0036503	Process	ERAD pathway	IMP	19822669
GO:0042802	Function	Identical protein binding	IPI	16189514, 16713569, 25416956
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12095988
GO:0048471	Component	Perinuclear region of cytoplasm	NAS	11853878
GO:0051051	Process	Negative regulation of transport	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	12095988
GO:0097352	Process	Autophagosome maturation	IMP	23459205
GO:1901340	Process	Negative regulation of store-operated calcium channel activity	IMP	23307288
GO:1902175	Process	Regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	12095988
GO:1904294	Process	Positive regulation of ERAD pathway	IEA
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	18307982

Other IDs

• MIM: 605046
• HGNC: 12508
• e!Ensembl: ENSG00000135018

Protein

• UniProt ID: Q9UMX0
• Protein name: Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1)
• Protein function: Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the prote
• PDB: 2JY5, 2JY6, 2KLC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	39 → 109	Ubiquitin family	Domain
  PF00627	UBA	546 → 583	UBA/TS-N domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain (at protein level) (PubMed:18953672). Ubiquitous. Highly expressed throughout the brain; detected in neurons and in neuropathological lesions, such as neurofibrillary tangles and Lewy bodies. Highly expressed in heart, placenta,
• Sequence:

  MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
  FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
  NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
  SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
  LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
  SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
  PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
  NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
  IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
  QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS

• Sequence length: 589

Pathways

KEGG:

Protein processing in endoplasmic reticulum
Amyotrophic lateral sclerosis

Reactome:

Cargo recognition for clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormal brain morphology	Likely pathogenic	rs1060499753	RCV000454188	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet, GenCC Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17409457, 29054976		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15745979, 19112176, 22952038, 24747970, 26261684, 28075048	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23360761	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	16302009		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	16278862, 17034007, 17704509, 18340109, 20350585		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26563932, 27324898		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19112176, 22766032		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	19112176, 24747970, 39271939	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21125662		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25044403, 26406952		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26406952, 34528694	Stimulate	★☆☆☆☆ Found in Text Mining only
Brown-Vialetto-Van Laere Syndrome 1	Brown-Vialetto-Van Laere Syndrome	BEFREE	22766032		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29054976	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34001851	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30204128		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27928652		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27928652, 31620993		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26415648		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	26415648		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	17947293, 18575606		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30352427		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24475300, 25511991		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	24747970	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	27928652		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17409457		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24747970, 32720736	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35063704	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26406952, 29505024, 34528694	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25044403, 26406952		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28212565		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29505024		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28075048, 29505024		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22272618		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	22766032		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	22766032	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26698246	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22134777, 26406952, 29505024		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29247619		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15492808		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22766032, 23360761, 28075048, 29505024, 33431932	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28598849, 29505024		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28212565		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28212565	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17709205		★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	24886140	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29505024		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29505024	Stimulate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	26415648		★☆☆☆☆ Found in Text Mining only