PSAT1 (phosphoserine aminotransferase 1)

Gene

• Entrez ID: 29968
• Gene name: Phosphoserine aminotransferase 1
• Gene symbol: PSAT1
• Synonyms (NCBI Gene): EPIP, NLS2, PSA, PSAT, PSATD
• Chromosome: 9
• Chromosome location: 9q21.2
• Summary: This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associa

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs118203967	A>C	Pathogenic	Coding sequence variant, missense variant
rs372232840	G>A,C	Likely-pathogenic	Intron variant
rs587777747	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs587777776	CCGGG>AGACCT	Pathogenic	Coding sequence variant, frameshift variant
rs587777777	C>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs587777778	C>T	Pathogenic	Missense variant, coding sequence variant
rs1008314756	G>A	Pathogenic	Stop gained, coding sequence variant
rs1057517807	CT>TG	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1554686365	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1564012541	G>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001427	hsa-miR-16-5p	pSILAC	18668040
MIRT020766	hsa-miR-155-5p	Proteomics	18668040
MIRT023797	hsa-miR-1-3p	Proteomics	18668040
MIRT029458	hsa-miR-26b-5p	Microarray	19088304
MIRT001427	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT046060	hsa-miR-125b-5p	CLASH	23622248
MIRT043679	hsa-miR-342-3p	CLASH	23622248
MIRT041083	hsa-miR-504-5p	CLASH	23622248
MIRT052767	hsa-miR-1260b	CLASH	23622248
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	20371350
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	20371350
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT175238	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT175237	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT175236	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT001427	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT175247	hsa-miR-548n	PAR-CLIP	20371350
MIRT175253	hsa-miR-548an	PAR-CLIP	20371350
MIRT175244	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT175241	hsa-miR-562	PAR-CLIP	20371350
MIRT521620	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT521619	hsa-miR-646	PAR-CLIP	20371350
MIRT175240	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	20371350
MIRT175259	hsa-miR-8067	PAR-CLIP	20371350
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT574512	hsa-miR-548ac	PAR-CLIP	20371350
MIRT574513	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT574511	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT574510	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT574509	hsa-miR-548z	PAR-CLIP	20371350
MIRT574508	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT574507	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT574506	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT574505	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT574504	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT574503	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT574502	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT574501	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT325192	hsa-miR-3200-3p	PAR-CLIP	20371350
MIRT325195	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT175253	hsa-miR-548an	PAR-CLIP	20371350
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT175235	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT521618	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT175250	hsa-miR-4477a	PAR-CLIP	20371350
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT175239	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT108016	hsa-miR-1260a	PAR-CLIP	20371350
MIRT052767	hsa-miR-1260b	PAR-CLIP	20371350
MIRT175235	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT521618	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT175250	hsa-miR-4477a	PAR-CLIP	20371350
MIRT175239	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT325184	hsa-miR-5692a	PAR-CLIP	20371350
MIRT325183	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT325186	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT534980	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT534979	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT175238	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT175237	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT175236	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT001427	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT175247	hsa-miR-548n	PAR-CLIP	21572407
MIRT175253	hsa-miR-548an	PAR-CLIP	21572407
MIRT175244	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT175241	hsa-miR-562	PAR-CLIP	21572407
MIRT521620	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT521619	hsa-miR-646	PAR-CLIP	21572407
MIRT175240	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	21572407
MIRT175259	hsa-miR-8067	PAR-CLIP	21572407
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT325184	hsa-miR-5692a	PAR-CLIP	22012620
MIRT325183	hsa-miR-508-5p	PAR-CLIP	22012620
MIRT325186	hsa-miR-6867-5p	PAR-CLIP	22012620
MIRT534980	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT534979	hsa-miR-642b-5p	PAR-CLIP	22012620
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	23446348
MIRT470208	hsa-miR-145-5p	PAR-CLIP	23446348
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	23446348
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	23446348
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	23446348
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	23446348
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT470199	hsa-miR-1297	PAR-CLIP	23446348
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT470197	hsa-miR-4465	PAR-CLIP	23446348
MIRT108016	hsa-miR-1260a	PAR-CLIP	23446348
MIRT052767	hsa-miR-1260b	PAR-CLIP	23446348
MIRT175238	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT175237	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT175236	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT001427	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT175247	hsa-miR-548n	PAR-CLIP	23446348
MIRT175253	hsa-miR-548an	PAR-CLIP	23446348
MIRT175244	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT175241	hsa-miR-562	PAR-CLIP	23446348
MIRT521620	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT521619	hsa-miR-646	PAR-CLIP	23446348
MIRT175235	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT175240	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	23446348
MIRT521618	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	23446348
MIRT175259	hsa-miR-8067	PAR-CLIP	23446348
MIRT521617	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT175250	hsa-miR-4477a	PAR-CLIP	23446348
MIRT521615	hsa-miR-33a-5p	PAR-CLIP	23446348
MIRT521614	hsa-miR-33b-5p	PAR-CLIP	23446348
MIRT175239	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT521613	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT365284	hsa-miR-3662	PAR-CLIP	23446348
MIRT365281	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT365283	hsa-miR-3646	PAR-CLIP	23446348
MIRT365287	hsa-miR-4790-3p	PAR-CLIP	23446348
MIRT365286	hsa-miR-3978	PAR-CLIP	23446348
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT175253	hsa-miR-548an	PAR-CLIP	23446348
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	23592263
MIRT470208	hsa-miR-145-5p	PAR-CLIP	23592263
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	23592263
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	23592263
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	23592263
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	23592263
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470199	hsa-miR-1297	PAR-CLIP	23592263
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT470197	hsa-miR-4465	PAR-CLIP	23592263
MIRT108016	hsa-miR-1260a	PAR-CLIP	23592263
MIRT052767	hsa-miR-1260b	PAR-CLIP	23592263
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT175253	hsa-miR-548an	PAR-CLIP	23592263
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT175232	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT175234	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT001427	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT175236	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT470199	hsa-miR-1297	PAR-CLIP	26701625
MIRT470199	hsa-miR-1297	PAR-CLIP	26701625
MIRT470208	hsa-miR-145-5p	PAR-CLIP	26701625
MIRT470208	hsa-miR-145-5p	PAR-CLIP	26701625
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	26701625
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	26701625
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	26701625
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	26701625
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	26701625
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	26701625
MIRT470197	hsa-miR-4465	PAR-CLIP	26701625
MIRT470197	hsa-miR-4465	PAR-CLIP	26701625
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	26701625
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	26701625
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	26701625
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	26701625
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	26701625
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	26701625
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	26701625
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	26701625
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	20371350
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	20371350
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT175238	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT175237	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT175236	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT001427	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT175247	hsa-miR-548n	PAR-CLIP	20371350
MIRT175253	hsa-miR-548an	PAR-CLIP	20371350
MIRT175244	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT175241	hsa-miR-562	PAR-CLIP	20371350
MIRT521620	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT521619	hsa-miR-646	PAR-CLIP	20371350
MIRT175240	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	20371350
MIRT175259	hsa-miR-8067	PAR-CLIP	20371350
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT574512	hsa-miR-548ac	PAR-CLIP	20371350
MIRT574513	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT574511	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT574510	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT574509	hsa-miR-548z	PAR-CLIP	20371350
MIRT574508	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT574507	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT574506	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT574505	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT574504	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT574503	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT574502	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT574501	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT325192	hsa-miR-3200-3p	PAR-CLIP	20371350
MIRT325195	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT175253	hsa-miR-548an	PAR-CLIP	20371350
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT175235	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT521618	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT175250	hsa-miR-4477a	PAR-CLIP	20371350
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT175239	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT108016	hsa-miR-1260a	PAR-CLIP	20371350
MIRT052767	hsa-miR-1260b	PAR-CLIP	20371350
MIRT175235	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT521618	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT175250	hsa-miR-4477a	PAR-CLIP	20371350
MIRT175239	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT325184	hsa-miR-5692a	PAR-CLIP	20371350
MIRT325183	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT325186	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT534980	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT534979	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	20371350
MIRT470208	hsa-miR-145-5p	PAR-CLIP	20371350
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	20371350
MIRT470199	hsa-miR-1297	PAR-CLIP	20371350
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT470197	hsa-miR-4465	PAR-CLIP	20371350
MIRT175238	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT175237	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT175236	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT001427	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT175247	hsa-miR-548n	PAR-CLIP	21572407
MIRT175253	hsa-miR-548an	PAR-CLIP	21572407
MIRT175244	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT175241	hsa-miR-562	PAR-CLIP	21572407
MIRT521620	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT521619	hsa-miR-646	PAR-CLIP	21572407
MIRT175240	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	21572407
MIRT175259	hsa-miR-8067	PAR-CLIP	21572407
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT325184	hsa-miR-5692a	PAR-CLIP	22012620
MIRT325183	hsa-miR-508-5p	PAR-CLIP	22012620
MIRT325186	hsa-miR-6867-5p	PAR-CLIP	22012620
MIRT534980	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT534979	hsa-miR-642b-5p	PAR-CLIP	22012620
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	23446348
MIRT470208	hsa-miR-145-5p	PAR-CLIP	23446348
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	23446348
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	23446348
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	23446348
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	23446348
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	23446348
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	23446348
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	23446348
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT470199	hsa-miR-1297	PAR-CLIP	23446348
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT470197	hsa-miR-4465	PAR-CLIP	23446348
MIRT108016	hsa-miR-1260a	PAR-CLIP	23446348
MIRT052767	hsa-miR-1260b	PAR-CLIP	23446348
MIRT175238	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT175237	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT175258	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT175234	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT175236	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT175232	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT001427	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT175247	hsa-miR-548n	PAR-CLIP	23446348
MIRT175253	hsa-miR-548an	PAR-CLIP	23446348
MIRT175244	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT175241	hsa-miR-562	PAR-CLIP	23446348
MIRT521620	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT521619	hsa-miR-646	PAR-CLIP	23446348
MIRT175235	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT175240	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT175254	hsa-miR-4742-5p	PAR-CLIP	23446348
MIRT521618	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT175256	hsa-miR-6508-5p	PAR-CLIP	23446348
MIRT175259	hsa-miR-8067	PAR-CLIP	23446348
MIRT521617	hsa-miR-302a-5p	PAR-CLIP	23446348
MIRT521616	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT175251	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT175255	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT175250	hsa-miR-4477a	PAR-CLIP	23446348
MIRT521615	hsa-miR-33a-5p	PAR-CLIP	23446348
MIRT521614	hsa-miR-33b-5p	PAR-CLIP	23446348
MIRT175239	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT521613	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT365284	hsa-miR-3662	PAR-CLIP	23446348
MIRT365281	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT365283	hsa-miR-3646	PAR-CLIP	23446348
MIRT365287	hsa-miR-4790-3p	PAR-CLIP	23446348
MIRT365286	hsa-miR-3978	PAR-CLIP	23446348
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT175253	hsa-miR-548an	PAR-CLIP	23446348
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT470209	hsa-miR-5195-3p	PAR-CLIP	23592263
MIRT470208	hsa-miR-145-5p	PAR-CLIP	23592263
MIRT470207	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT470206	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT470205	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT470204	hsa-miR-1224-3p	PAR-CLIP	23592263
MIRT470203	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT470202	hsa-miR-516a-3p	PAR-CLIP	23592263
MIRT470201	hsa-miR-516b-3p	PAR-CLIP	23592263
MIRT470200	hsa-miR-7162-5p	PAR-CLIP	23592263
MIRT108020	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470199	hsa-miR-1297	PAR-CLIP	23592263
MIRT470198	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029458	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT470197	hsa-miR-4465	PAR-CLIP	23592263
MIRT108016	hsa-miR-1260a	PAR-CLIP	23592263
MIRT052767	hsa-miR-1260b	PAR-CLIP	23592263
MIRT108025	hsa-miR-548e-5p	PAR-CLIP	23592263
MIRT175253	hsa-miR-548an	PAR-CLIP	23592263
MIRT175242	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT1269147	hsa-miR-139-5p	CLIP-seq
MIRT1269148	hsa-miR-15a	CLIP-seq
MIRT1269149	hsa-miR-15b	CLIP-seq
MIRT1269150	hsa-miR-16	CLIP-seq
MIRT1269151	hsa-miR-186	CLIP-seq
MIRT1269152	hsa-miR-195	CLIP-seq
MIRT1269153	hsa-miR-1976	CLIP-seq
MIRT1269154	hsa-miR-2054	CLIP-seq
MIRT1269155	hsa-miR-3074-3p	CLIP-seq
MIRT1269156	hsa-miR-3157-3p	CLIP-seq
MIRT1269157	hsa-miR-33a	CLIP-seq
MIRT1269158	hsa-miR-33b	CLIP-seq
MIRT1269159	hsa-miR-3688-3p	CLIP-seq
MIRT1269160	hsa-miR-424	CLIP-seq
MIRT1269161	hsa-miR-4276	CLIP-seq
MIRT1269162	hsa-miR-4279	CLIP-seq
MIRT1269163	hsa-miR-4511	CLIP-seq
MIRT1269164	hsa-miR-4524	CLIP-seq
MIRT1269165	hsa-miR-4742-3p	CLIP-seq
MIRT1269166	hsa-miR-4795-3p	CLIP-seq
MIRT1269167	hsa-miR-486-5p	CLIP-seq
MIRT1269168	hsa-miR-497	CLIP-seq
MIRT1269169	hsa-miR-503	CLIP-seq
MIRT1269170	hsa-miR-545	CLIP-seq
MIRT1269171	hsa-miR-582-5p	CLIP-seq
MIRT1269172	hsa-miR-668	CLIP-seq
MIRT1269173	hsa-miR-874	CLIP-seq
MIRT1269174	hsa-miR-891b	CLIP-seq
MIRT1269175	hsa-miR-938	CLIP-seq
MIRT1269176	hsa-miR-2052	CLIP-seq
MIRT1269177	hsa-miR-2116	CLIP-seq
MIRT1269178	hsa-miR-2276	CLIP-seq
MIRT1269179	hsa-miR-3613-3p	CLIP-seq
MIRT1269180	hsa-miR-3691-5p	CLIP-seq
MIRT1269181	hsa-miR-4273	CLIP-seq
MIRT1269182	hsa-miR-4307	CLIP-seq
MIRT1269183	hsa-miR-4677-5p	CLIP-seq
MIRT1269184	hsa-miR-4752	CLIP-seq
MIRT1269185	hsa-miR-4764-5p	CLIP-seq
MIRT1269186	hsa-miR-4772-3p	CLIP-seq
MIRT1269187	hsa-miR-4797-5p	CLIP-seq
MIRT1269188	hsa-miR-607	CLIP-seq
MIRT1269148	hsa-miR-15a	CLIP-seq
MIRT1269149	hsa-miR-15b	CLIP-seq
MIRT1269150	hsa-miR-16	CLIP-seq
MIRT1269152	hsa-miR-195	CLIP-seq
MIRT1552657	hsa-miR-203	CLIP-seq
MIRT1269160	hsa-miR-424	CLIP-seq
MIRT1269164	hsa-miR-4524	CLIP-seq
MIRT1269168	hsa-miR-497	CLIP-seq
MIRT1269169	hsa-miR-503	CLIP-seq
MIRT2079079	hsa-miR-421	CLIP-seq
MIRT2079080	hsa-miR-4709-5p	CLIP-seq
MIRT2079081	hsa-miR-4768-3p	CLIP-seq
MIRT2079082	hsa-miR-576-3p	CLIP-seq
MIRT2079083	hsa-miR-665	CLIP-seq
MIRT2305368	hsa-miR-1226	CLIP-seq
MIRT2305369	hsa-miR-1260	CLIP-seq
MIRT2305370	hsa-miR-1280	CLIP-seq
MIRT1269147	hsa-miR-139-5p	CLIP-seq
MIRT2305371	hsa-miR-145	CLIP-seq
MIRT1269148	hsa-miR-15a	CLIP-seq
MIRT1269149	hsa-miR-15b	CLIP-seq
MIRT1269150	hsa-miR-16	CLIP-seq
MIRT2305372	hsa-miR-18a	CLIP-seq
MIRT2305373	hsa-miR-18b	CLIP-seq
MIRT1269152	hsa-miR-195	CLIP-seq
MIRT1269153	hsa-miR-1976	CLIP-seq
MIRT2305374	hsa-miR-200b	CLIP-seq
MIRT2305375	hsa-miR-200c	CLIP-seq
MIRT1269176	hsa-miR-2052	CLIP-seq
MIRT1269154	hsa-miR-2054	CLIP-seq
MIRT2305376	hsa-miR-26a	CLIP-seq
MIRT2305377	hsa-miR-26b	CLIP-seq
MIRT2305378	hsa-miR-297	CLIP-seq
MIRT1269155	hsa-miR-3074-3p	CLIP-seq
MIRT2305379	hsa-miR-3125	CLIP-seq
MIRT2305380	hsa-miR-3149	CLIP-seq
MIRT2305381	hsa-miR-3150a-3p	CLIP-seq
MIRT2305382	hsa-miR-3152-3p	CLIP-seq
MIRT2305383	hsa-miR-3153	CLIP-seq
MIRT2305384	hsa-miR-3175	CLIP-seq
MIRT2305385	hsa-miR-34c-3p	CLIP-seq
MIRT2305386	hsa-miR-3618	CLIP-seq
MIRT2305387	hsa-miR-3674	CLIP-seq
MIRT1269180	hsa-miR-3691-5p	CLIP-seq
MIRT2305388	hsa-miR-3916	CLIP-seq
MIRT2305389	hsa-miR-3973	CLIP-seq
MIRT2305390	hsa-miR-410	CLIP-seq
MIRT1269160	hsa-miR-424	CLIP-seq
MIRT1269161	hsa-miR-4276	CLIP-seq
MIRT1269162	hsa-miR-4279	CLIP-seq
MIRT2305391	hsa-miR-429	CLIP-seq
MIRT2305392	hsa-miR-4291	CLIP-seq
MIRT1269182	hsa-miR-4307	CLIP-seq
MIRT2305393	hsa-miR-4318	CLIP-seq
MIRT2305394	hsa-miR-4463	CLIP-seq
MIRT2305395	hsa-miR-4476	CLIP-seq
MIRT1269163	hsa-miR-4511	CLIP-seq
MIRT1269164	hsa-miR-4524	CLIP-seq
MIRT2305396	hsa-miR-4667-5p	CLIP-seq
MIRT2305397	hsa-miR-4693-5p	CLIP-seq
MIRT2305398	hsa-miR-4700-5p	CLIP-seq
MIRT2305399	hsa-miR-4728-5p	CLIP-seq
MIRT1269184	hsa-miR-4752	CLIP-seq
MIRT1269185	hsa-miR-4764-5p	CLIP-seq
MIRT2305400	hsa-miR-4781-3p	CLIP-seq
MIRT1269187	hsa-miR-4797-5p	CLIP-seq
MIRT2305401	hsa-miR-4799-5p	CLIP-seq
MIRT1269167	hsa-miR-486-5p	CLIP-seq
MIRT1269168	hsa-miR-497	CLIP-seq
MIRT1269169	hsa-miR-503	CLIP-seq
MIRT1269170	hsa-miR-545	CLIP-seq
MIRT2305402	hsa-miR-548l	CLIP-seq
MIRT2305403	hsa-miR-548t	CLIP-seq
MIRT2305404	hsa-miR-548u	CLIP-seq
MIRT2305405	hsa-miR-567	CLIP-seq
MIRT2305406	hsa-miR-577	CLIP-seq
MIRT2305407	hsa-miR-583	CLIP-seq
MIRT1269172	hsa-miR-668	CLIP-seq
MIRT2305408	hsa-miR-892a	CLIP-seq
MIRT2305409	hsa-miR-934	CLIP-seq
MIRT2305410	hsa-miR-939	CLIP-seq
MIRT2305368	hsa-miR-1226	CLIP-seq
MIRT2305369	hsa-miR-1260	CLIP-seq
MIRT2305370	hsa-miR-1280	CLIP-seq
MIRT1269147	hsa-miR-139-5p	CLIP-seq
MIRT1269153	hsa-miR-1976	CLIP-seq
MIRT1269154	hsa-miR-2054	CLIP-seq
MIRT2305383	hsa-miR-3153	CLIP-seq
MIRT2432298	hsa-miR-323-3p	CLIP-seq
MIRT2305385	hsa-miR-34c-3p	CLIP-seq
MIRT2305389	hsa-miR-3973	CLIP-seq
MIRT1269162	hsa-miR-4279	CLIP-seq
MIRT2305392	hsa-miR-4291	CLIP-seq
MIRT1269187	hsa-miR-4797-5p	CLIP-seq
MIRT1269167	hsa-miR-486-5p	CLIP-seq
MIRT1269170	hsa-miR-545	CLIP-seq
MIRT2305402	hsa-miR-548l	CLIP-seq
MIRT2305404	hsa-miR-548u	CLIP-seq
MIRT2305406	hsa-miR-577	CLIP-seq
MIRT1269171	hsa-miR-582-5p	CLIP-seq
MIRT1269172	hsa-miR-668	CLIP-seq
MIRT2602494	hsa-miR-1206	CLIP-seq
MIRT2305368	hsa-miR-1226	CLIP-seq
MIRT2305369	hsa-miR-1260	CLIP-seq
MIRT2305370	hsa-miR-1280	CLIP-seq
MIRT2305371	hsa-miR-145	CLIP-seq
MIRT1269148	hsa-miR-15a	CLIP-seq
MIRT1269149	hsa-miR-15b	CLIP-seq
MIRT1269150	hsa-miR-16	CLIP-seq
MIRT2602495	hsa-miR-192	CLIP-seq
MIRT1269152	hsa-miR-195	CLIP-seq
MIRT2305374	hsa-miR-200b	CLIP-seq
MIRT2305375	hsa-miR-200c	CLIP-seq
MIRT1552657	hsa-miR-203	CLIP-seq
MIRT1269176	hsa-miR-2052	CLIP-seq
MIRT2602496	hsa-miR-2115	CLIP-seq
MIRT1269177	hsa-miR-2116	CLIP-seq
MIRT2602497	hsa-miR-215	CLIP-seq
MIRT1269178	hsa-miR-2276	CLIP-seq
MIRT2602498	hsa-miR-296-5p	CLIP-seq
MIRT2602499	hsa-miR-3065-3p	CLIP-seq
MIRT2602500	hsa-miR-3123	CLIP-seq
MIRT2305382	hsa-miR-3152-3p	CLIP-seq
MIRT2305383	hsa-miR-3153	CLIP-seq
MIRT2602501	hsa-miR-3162-3p	CLIP-seq
MIRT2432298	hsa-miR-323-3p	CLIP-seq
MIRT1269157	hsa-miR-33a	CLIP-seq
MIRT1269158	hsa-miR-33b	CLIP-seq
MIRT2305385	hsa-miR-34c-3p	CLIP-seq
MIRT1269179	hsa-miR-3613-3p	CLIP-seq
MIRT2305387	hsa-miR-3674	CLIP-seq
MIRT1269180	hsa-miR-3691-5p	CLIP-seq
MIRT2602502	hsa-miR-3925-5p	CLIP-seq
MIRT2602503	hsa-miR-3935	CLIP-seq
MIRT2305389	hsa-miR-3973	CLIP-seq
MIRT2602504	hsa-miR-409-3p	CLIP-seq
MIRT2079079	hsa-miR-421	CLIP-seq
MIRT1269160	hsa-miR-424	CLIP-seq
MIRT1269181	hsa-miR-4273	CLIP-seq
MIRT2305391	hsa-miR-429	CLIP-seq
MIRT2305392	hsa-miR-4291	CLIP-seq
MIRT1269182	hsa-miR-4307	CLIP-seq
MIRT2305393	hsa-miR-4318	CLIP-seq
MIRT1269164	hsa-miR-4524	CLIP-seq
MIRT2602505	hsa-miR-4639-3p	CLIP-seq
MIRT1269183	hsa-miR-4677-5p	CLIP-seq
MIRT2602506	hsa-miR-4691-5p	CLIP-seq
MIRT2305397	hsa-miR-4693-5p	CLIP-seq
MIRT2079080	hsa-miR-4709-5p	CLIP-seq
MIRT1269184	hsa-miR-4752	CLIP-seq
MIRT1269185	hsa-miR-4764-5p	CLIP-seq
MIRT2079081	hsa-miR-4768-3p	CLIP-seq
MIRT1269186	hsa-miR-4772-3p	CLIP-seq
MIRT1269187	hsa-miR-4797-5p	CLIP-seq
MIRT2602507	hsa-miR-483-3p	CLIP-seq
MIRT2602508	hsa-miR-485-3p	CLIP-seq
MIRT1269168	hsa-miR-497	CLIP-seq
MIRT1269169	hsa-miR-503	CLIP-seq
MIRT2602509	hsa-miR-520d-5p	CLIP-seq
MIRT2602510	hsa-miR-524-5p	CLIP-seq
MIRT2602511	hsa-miR-539	CLIP-seq
MIRT1269170	hsa-miR-545	CLIP-seq
MIRT2305402	hsa-miR-548l	CLIP-seq
MIRT2305404	hsa-miR-548u	CLIP-seq
MIRT2602512	hsa-miR-570	CLIP-seq
MIRT2079082	hsa-miR-576-3p	CLIP-seq
MIRT2305406	hsa-miR-577	CLIP-seq
MIRT2602513	hsa-miR-579	CLIP-seq
MIRT2602514	hsa-miR-580	CLIP-seq
MIRT1269188	hsa-miR-607	CLIP-seq
MIRT2079083	hsa-miR-665	CLIP-seq
MIRT1269174	hsa-miR-891b	CLIP-seq
MIRT2305408	hsa-miR-892a	CLIP-seq
MIRT2602515	hsa-miR-936	CLIP-seq
MIRT2602494	hsa-miR-1206	CLIP-seq
MIRT2305368	hsa-miR-1226	CLIP-seq
MIRT2305369	hsa-miR-1260	CLIP-seq
MIRT2305370	hsa-miR-1280	CLIP-seq
MIRT2305371	hsa-miR-145	CLIP-seq
MIRT1269148	hsa-miR-15a	CLIP-seq
MIRT1269149	hsa-miR-15b	CLIP-seq
MIRT1269150	hsa-miR-16	CLIP-seq
MIRT2602495	hsa-miR-192	CLIP-seq
MIRT1269152	hsa-miR-195	CLIP-seq
MIRT2305374	hsa-miR-200b	CLIP-seq
MIRT2305375	hsa-miR-200c	CLIP-seq
MIRT1552657	hsa-miR-203	CLIP-seq
MIRT1269176	hsa-miR-2052	CLIP-seq
MIRT2602496	hsa-miR-2115	CLIP-seq
MIRT1269177	hsa-miR-2116	CLIP-seq
MIRT2602497	hsa-miR-215	CLIP-seq
MIRT1269178	hsa-miR-2276	CLIP-seq
MIRT2305376	hsa-miR-26a	CLIP-seq
MIRT2305377	hsa-miR-26b	CLIP-seq
MIRT2602498	hsa-miR-296-5p	CLIP-seq
MIRT2305378	hsa-miR-297	CLIP-seq
MIRT2602499	hsa-miR-3065-3p	CLIP-seq
MIRT2602500	hsa-miR-3123	CLIP-seq
MIRT2305380	hsa-miR-3149	CLIP-seq
MIRT2305382	hsa-miR-3152-3p	CLIP-seq
MIRT2305383	hsa-miR-3153	CLIP-seq
MIRT2602501	hsa-miR-3162-3p	CLIP-seq
MIRT2432298	hsa-miR-323-3p	CLIP-seq
MIRT1269157	hsa-miR-33a	CLIP-seq
MIRT1269158	hsa-miR-33b	CLIP-seq
MIRT2305385	hsa-miR-34c-3p	CLIP-seq
MIRT1269179	hsa-miR-3613-3p	CLIP-seq
MIRT2305387	hsa-miR-3674	CLIP-seq
MIRT1269180	hsa-miR-3691-5p	CLIP-seq
MIRT2602502	hsa-miR-3925-5p	CLIP-seq
MIRT2602503	hsa-miR-3935	CLIP-seq
MIRT2305389	hsa-miR-3973	CLIP-seq
MIRT2602504	hsa-miR-409-3p	CLIP-seq
MIRT2079079	hsa-miR-421	CLIP-seq
MIRT1269160	hsa-miR-424	CLIP-seq
MIRT1269181	hsa-miR-4273	CLIP-seq
MIRT2305391	hsa-miR-429	CLIP-seq
MIRT2305392	hsa-miR-4291	CLIP-seq
MIRT1269182	hsa-miR-4307	CLIP-seq
MIRT2305393	hsa-miR-4318	CLIP-seq
MIRT1269164	hsa-miR-4524	CLIP-seq
MIRT2602505	hsa-miR-4639-3p	CLIP-seq
MIRT1269183	hsa-miR-4677-5p	CLIP-seq
MIRT2602506	hsa-miR-4691-5p	CLIP-seq
MIRT2305397	hsa-miR-4693-5p	CLIP-seq
MIRT2079080	hsa-miR-4709-5p	CLIP-seq
MIRT1269184	hsa-miR-4752	CLIP-seq
MIRT1269185	hsa-miR-4764-5p	CLIP-seq
MIRT2079081	hsa-miR-4768-3p	CLIP-seq
MIRT1269186	hsa-miR-4772-3p	CLIP-seq
MIRT1269187	hsa-miR-4797-5p	CLIP-seq
MIRT2602507	hsa-miR-483-3p	CLIP-seq
MIRT2602508	hsa-miR-485-3p	CLIP-seq
MIRT1269168	hsa-miR-497	CLIP-seq
MIRT1269169	hsa-miR-503	CLIP-seq
MIRT2602509	hsa-miR-520d-5p	CLIP-seq
MIRT2602510	hsa-miR-524-5p	CLIP-seq
MIRT2602511	hsa-miR-539	CLIP-seq
MIRT1269170	hsa-miR-545	CLIP-seq
MIRT2305402	hsa-miR-548l	CLIP-seq
MIRT2305404	hsa-miR-548u	CLIP-seq
MIRT2602512	hsa-miR-570	CLIP-seq
MIRT2079082	hsa-miR-576-3p	CLIP-seq
MIRT2305406	hsa-miR-577	CLIP-seq
MIRT2602513	hsa-miR-579	CLIP-seq
MIRT2602514	hsa-miR-580	CLIP-seq
MIRT1269188	hsa-miR-607	CLIP-seq
MIRT2079083	hsa-miR-665	CLIP-seq
MIRT1269174	hsa-miR-891b	CLIP-seq
MIRT2305408	hsa-miR-892a	CLIP-seq
MIRT2602515	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004648	Function	O-phospho-L-serine:2-oxoglutarate aminotransferase activity	IBA
GO:0004648	Function	O-phospho-L-serine:2-oxoglutarate aminotransferase activity	IDA	37627284
GO:0004648	Function	O-phospho-L-serine:2-oxoglutarate aminotransferase activity	IEA
GO:0004648	Function	O-phospho-L-serine:2-oxoglutarate aminotransferase activity	NAS	10637769
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006563	Process	L-serine metabolic process	IEA
GO:0006564	Process	L-serine biosynthetic process	IBA
GO:0006564	Process	L-serine biosynthetic process	IDA	37627284
GO:0006564	Process	L-serine biosynthetic process	IEA
GO:0006564	Process	L-serine biosynthetic process	NAS	10637769
GO:0008483	Function	Transaminase activity	IEA
GO:0008615	Process	Pyridoxine biosynthetic process	NAS	10637769
GO:0008652	Process	Amino acid biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IBA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337

Other IDs

• MIM: 610936
• HGNC: 19129
• e!Ensembl: ENSG00000135069

Protein

• UniProt ID: Q9Y617
• Protein name: Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) (PSAT)
• Protein function: Involved in L-serine biosynthesis via the phosphorylated pathway, a three-step pathway converting the glycolytic intermediate 3-phospho-D-glycerate into L-serine. Catalyzes the second step, that is the pyridoxal 5'-phosphate-dependent transamina
• PDB: 3E77, 8A5V, 8A5W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00266	Aminotran_5	7 → 357	Aminotransferase class-V	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon. {ECO:0000269|PubMed:12633500}.
• Sequence:

  MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
  RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
  INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
  FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
  NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
  MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
  MKKFLEMHQL

• Sequence length: 370

Pathways

KEGG:

Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Vitamin B6 metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Biosynthesis of cofactors

Reactome:

Serine biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Neu-Laxova syndrome 2	Likely pathogenic; Pathogenic	rs376824714, rs2118643983, rs1828216198, rs2118681775, rs199998249, rs148598272, rs765723196, rs772958302, rs587777747, rs118203967, rs587777776, rs587777777, rs919827103, rs2489629517, rs2489697040, rs2489696870, rs2489639860, rs1828184824, rs2489650770, rs2489644879, rs756304890, rs2489640547, rs2489629497, rs2489645698, rs1057517807, rs1564012541, rs1008314756	RCV002032850 RCV002046923 RCV002017210 RCV001939663 RCV001966488 RCV001972869 RCV001901588 RCV002045140 RCV003586120 RCV003586121 RCV000144446 RCV000144447 RCV003060182 RCV002952911 RCV002953061 RCV003013390 RCV003016652 RCV003033065 RCV003777339 RCV003748487 RCV003586619 RCV003587095 RCV003843829 RCV005064943 RCV000819927 RCV000702162 RCV000810596	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurometabolic disorder due to serine deficiency	Likely pathogenic; Pathogenic	rs376824714	RCV005361710	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PSAT deficiency	Likely pathogenic; Pathogenic	rs148598272, rs587777747, rs118203967, rs2489629517, rs1554686365, rs1828113460	RCV001808201 RCV000001136 RCV000001137 RCV005399030 RCV003388586 RCV004004918	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PSAT1-related disorder	Likely pathogenic; Pathogenic	rs118203967, rs2489697040, rs2489644879, rs2489645698, rs1057517807	RCV006263611 RCV003230758 RCV003331902 RCV003994858 RCV005238963	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Absence of septum pellucidum	Absence Of Septum Pellucidum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	28081259		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12530069, 18491956, 2195744, 31013476, 9712452		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31036704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10188912, 10667479, 15350307, 18584300, 23318356, 29416625, 29894516, 30402808, 30789396, 31162264, 31304057		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29998354		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12955080		★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10893635		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28623635		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	17429411, 28623635		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	21212260, 23130941, 27743893		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30885050		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27749230		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30885050		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	16286983		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10458410, 12949428, 15283888, 16516186, 18076912, 18222179, 18722876, 19462463, 22298030, 22731640, 23470460, 23620269, 24711254, 26831660, 27818346, 28211173, 28300542, 28327526, 28430620, 28617988, 28752596, 29100363, 29203798, 30087706, 30186533, 30341416, 30410027, 31288722, 31534967, 31569672, 7533062		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30651033		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28764970		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	15154626		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10188912, 12142380, 15647832, 16365023, 16897430, 18646000, 20352489, 28522855, 28795403, 29109015, 29216929, 29661856, 30254080, 31664946		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33112838, 34990474, 35045283, 35231654, 40691196	Associate	★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	28813037		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27881017, 31534629, 7512791		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25053597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30176945	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25053597	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	27277113	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28764970		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29736949, 30174274, 31810937		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22321069, 32737333, 33564363	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16950394, 21787114, 31171023		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	29203116, 30540597		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28608963, 29658833, 30358898, 30885050		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	10068342, 29138196		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	12474530		★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30237546		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	18216146		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28551659		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29169663		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23776434		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18221502	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29344244, 30555259		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18221502		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18221502, 25206290, 31268166, 35615948, 36821417	Associate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital microcephaly	Congenital Microcephaly	BEFREE	26610677		★☆☆☆☆ Found in Text Mining only
Congenital microcephaly	Congenital Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31570754		★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	28762373, 29248950		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31621538		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30364237, 31234367, 31440861		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30364237, 31234367, 31440861		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31234367	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20203524, 25503742, 29658833		★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	27489290		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	26610677		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	33112838	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36906716	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30410394		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30410394		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29672864		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18752058, 21381033, 28291903, 29523813, 29905907, 29988684, 31163438, 31296901, 31492993		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31160348		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30909789		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37823569, 38098117, 40258222	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30909789		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	37812589	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28762373, 29248950		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15289356		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12471593, 17957791		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	17187781, 17400200		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30619769		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37823569, 40258222	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	34089226	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26960553		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32077105, 37812589	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12142383		★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27818006		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	30176945	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16043123		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31630284		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38038618	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15350307		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15350307		★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15289356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10188912, 12142380, 15647832, 16365023, 16897430, 18646000, 20352489, 28795403, 29109015, 29216929, 29661856, 30254080, 31664946		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30410394		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31044493		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29736949, 30174274, 31534629, 31810937		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16950394, 21787114, 31171023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10098501, 10188912, 10223486, 10379797, 10569618, 10652560, 10792086, 11034093, 11212244, 11254449, 11507044, 11571582, 11857020, 11948967, 12023131, 12142373, 12142380, 12142383, 12218299, 12242725, 12471593, 12581210, 12735498, 12814669, 12858354, 12949428, 14572750, 14607215, 14743461, 14755677, 15036671, 15050332, 15154626, 15322319, 15350307, 15368351, 15389792, 15474988, 15503828, 15543614, 15649863, 15678150, 15705654, 15754351, 15911097, 15948728, 16000958, 16015610, 16043123, 16126332, 16172228, 16175585, 16381942, 16388501, 16516186, 16774685, 16983328, 17012834, 17044040, 1712248, 17151093, 17303324, 17320159, 17440964, 17450530, 17467883, 17568188, 17629406, 17647201, 17957791, 17984071, 17991549, 18061337, 18076912, 18222179, 18225585, 18245536, 18361410, 18422767, 18431597, 18497063, 18627304, 18640109, 18646000, 18697814, 18722876, 18757426, 18780294, 18801539, 18827812, 18836306, 18846227, 19013180, 19095061, 19100308, 19116992, 19424173, 19434657, 19459176, 19462463, 19489685, 19507229, 19548854, 19575420, 19683515, 20065953, 20099974, 20180647, 20203524, 20302518, 20424135, 20451417, 20531306, 20632874, 20842666, 20860009, 20957673, 20967219, 20970419, 21095422, 21129724, 21160075, 21166744, 21212260, 21318478, 21345070, 21465221, 21520154, 21584487, 21600800, 21647377, 21788966, 21791629, 21813756, 21826098, 21939492, 21959049, 21969603, 21979296, 22019475, 22025344, 22047144, 22113713, 22154085, 22234006, 22281794, 22347450, 22528335, 22555040, 22576683, 22595052, 22642976, 22687565, 22703285, 22705054, 22765866, 22792137, 22820620, 23129512, 23213189, 23292082, 23318363, 23370768, 23381693, 23391636, 23433128, 23459097, 23464444, 23470460, 23527518, 23666742, 23737135, 23773345, 23792811, 23794398, 23826159, 23826841, 23843146, 23861782, 23939133, 23948277, 23958433, 24037955, 24120391, 24324057, 24338276, 24604720, 24627192, 24788382, 24820830, 24835310, 24849040, 24854630, 24952954, 25101567, 25352524, 25422221, 25540025, 25563847, 25686826, 25750310, 25769446, 25876105, 25889691, 25891023, 25969992, 26030748, 26068399, 26125925, 26134445, 26169045, 26171803, 26332453, 26339409, 26343558, 26345389, 26369530, 26383228, 26431041, 26458958, 26614400, 26620456, 26689513, 26773531, 26782586, 26831660, 26847530, 26868935, 26871947, 26908062, 27038170, 27060154, 27076165, 27084245, 27102235, 27120785, 27121847, 27148956, 27189160, 27236302, 27289238, 27400876, 27460552, 27470540, 27481175, 27518576, 27522256, 27699819, 27718273, 27725729, 27726850, 27741522, 27741552, 27742670, 27775154, 27793023, 27803051, 27807905, 27818346, 27819756, 27824042, 27834470, 27871928, 27893706, 27897172, 27922627, 27987030, 27995937, 28045113, 28058757, 28081259, 28085790, 28094250, 28094251, 28117382, 28117387, 28121355, 28124523, 28124526, 28134773, 28138747, 28143868, 28157066, 28160549, 28162815, 28176139, 28283654, 28283782, 28291906, 28293631, 28296582, 28299763, 28322234, 28364014, 28376158, 28391870, 28399576, 28410987, 28416350, 28418195, 28431993, 28433413, 28464446, 28495148, 28524006, 28529650, 28534659, 28535696, 28558685, 28586946, 28607597, 28609648, 28615058, 28617988, 28621736, 28634111, 28679370, 28694142, 28695317, 28695916, 28701750, 28703328, 28715578, 28752596, 28762124, 28764970, 28767721, 28783264, 28791252, 28793236, 28795218, 28813037, 28841855, 28882030, 28882187, 28899491, 28905400, 28919101, 28923030, 28939158, 28948333, 28974201, 28981735, 28994485, 29020868, 29029032, 29044297, 29044563, 29076912, 29084410, 29088771, 29094851, 29099733, 29100363, 29105797, 29108322, 29122836, 29126446, 29129952, 29138196, 29149380, 29155186, 29156615, 29171259, 29184786, 29189229, 29203798, 29206164, 29232037, 29248950, 29260633, 29278842, 29284055, 29301143, 29304771, 29307509, 29308527, 29321194, 29322512, 29326690, 29339807, 29372688, 29383739, 29386538, 29405172, 29416625, 29429895, 29434372, 29448139, 29454309, 29464033, 29465428, 29499730, 29499779, 29508048, 29518100, 29522280, 29523813, 29535815, 29570262, 29580912, 29588330, 29595681, 29617073, 29630104, 29630957, 29635526, 29650035, 29650325, 29659051, 29667616, 29686358, 29696637, 29745629, 29772100, 29781117, 29794067, 29797600, 29801018, 29803408, 29855276, 29885274, 29905907, 29990335, 30002108, 30003374, 30012385, 30027591, 30031467, 30037211, 30041764, 30047547, 30049237, 30073682, 30075951, 30105521, 30113755, 30121424, 30126402, 30171228, 30173421, 30176851, 30178243, 30179618, 30181389, 30186533, 30193693, 30215656, 30222680, 30237027, 30265884, 30267820, 30284481, 30294801, 30301636, 30325021, 30325610, 30327584, 30334974, 30342844, 30365141, 30386737, 30388485, 30394930, 30470253, 30506128, 30538797, 30540597, 30564911, 30565302, 30592769, 30595465, 30617554, 30643974, 30653262, 30660434, 30679762, 30683712, 30767493, 30862227, 30868389, 30885050, 30905464, 30917943, 30950457, 30958910, 30962017, 30972506, 30980038, 30989489, 30990112, 30996714, 31001481, 31004342, 31016435, 31045267, 31047912, 31090082, 31118771, 31122297, 31125365, 31128043, 31144489, 31156017, 31160348, 31166103, 31169140, 31172275, 31178436, 31190297, 31209634, 31261602, 31270961, 31284686, 31288722, 31305891, 31319390, 31338731, 31363165, 31392072, 31399825, 31421657, 31436568, 31446281, 31448239, 31454725, 31492993, 31502084, 31516752, 31534629, 31534967, 31563066, 31588336, 31615476, 31628565, 31642740, 31690449, 31691526, 31695139, 31695844, 31711243, 31711524, 31711843, 31715513, 31722940, 31731188, 31733275, 31743339, 31749145, 31759363, 31766715, 31779677, 31780781, 31795990, 31808398, 31851457, 7524153, 7538236, 8543402, 8753736, 8968092, 9428387, 9989206		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28764970		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10571186, 11948967, 12218299, 12439719, 12876620, 12907647, 14743461, 15192120, 15368467, 16286983, 17001673, 17568188, 18640109, 18794087, 18800346, 19436291, 20945500, 20957673, 20967219, 21445975, 21788966, 22047144, 22083266, 23292082, 23722471, 23941784, 24927162, 24997128, 25686826, 26343558, 26458958, 26783378, 26813356, 26871947, 27543619, 27768168, 27775154, 27818346, 27824042, 28108045, 28143868, 28157066, 28161841, 28191793, 28299763, 28436357, 28615267, 28715578, 28725580, 28764970, 28851376, 29024425, 29029032, 29232037, 29248950, 29278842, 29312542, 29465157, 29569310, 29689706, 29765545, 29808301, 30037211, 30204798, 30233396, 30378238, 30415878, 30477387, 30599876, 30664734, 31147981, 31156017, 31444696, 31534967, 31554135, 31810937		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10188912		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28115200		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	27277113		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16381942, 29518100		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28500236, 40691196	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31621538		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30058042		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29434372, 29925936		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	10569618, 19436291, 28097317, 28338310, 28588730, 29050295, 29663462, 29735818, 30232224		★☆☆☆☆ Found in Text Mining only
Methylmalonic acidemia	Methylmalonic acidemia	Pubtator	31449969	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28535696		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	39186541	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10068342, 10223486, 10472353, 10537358, 10749132, 10881018, 10893635, 10928161, 10960844, 11212244, 11589829, 11747336, 11857028, 11948967, 12036918, 12142373, 12142380, 12487060, 12504055, 12530069, 12640659, 12894532, 14743461, 14991898, 15053304, 15107801, 15283888, 15503828, 15754319, 15911097, 16015610, 16172228, 16175585, 16381942, 16516186, 16721785, 16741920, 16827116, 17182240, 17257635, 17467883, 17879940, 18175332, 18324645, 18752043, 19148481, 19267352, 19683515, 20494973, 20583134, 20860009, 21031435, 21212260, 21216933, 21390317, 21520153, 21712449, 21739464, 21858228, 21939492, 22347450, 22642976, 23381693, 23939133, 23941784, 23948277, 24012641, 24052127, 24099827, 24261794, 24345439, 24353088, 24604720, 24627192, 25138562, 25153390, 25165096, 25351916, 25403418, 25521481, 25563847, 25769446, 25794974, 25798940, 25937368, 26030748, 26106075, 26238234, 26316084, 26392259, 26435505, 26614400, 26731648, 26754263, 26773531, 26944919, 27060154, 27085489, 27120785, 27271990, 27372650, 27803051, 27826729, 28117816, 28134773, 28138747, 28143868, 28160549, 28364014, 28389510, 28497198, 28500489, 28522855, 28678638, 28993510, 29044297, 29101444, 29105797, 29204705, 29322512, 29413967, 29570821, 29572953, 29606109, 29630104, 29659051, 29661963, 29855276, 29885274, 29886377, 30063011, 30155992, 30342845, 30410394, 30592769, 30600483, 30674952, 30679762, 30700328, 30885050, 30950457, 30980038, 31014300, 31136108, 31210308, 31269285, 31359744, 31383039, 31557128, 31711982, 31732768, 31742767, 31745645, 31767941, 7536128, 7538903, 7954242, 8753736, 8824549, 9581866, 9815800		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	34089226	Associate	★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	ORPHANET_DG	25152457		★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	BEFREE	30838783		★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Neu-Laxova syndrome	Neu-Laxova Syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
NEU-LAXOVA SYNDROME 1	Neu-Laxova Syndrome	GENOMICS_ENGLAND_DG	17436247		★☆☆☆☆ Found in Text Mining only
NEU-LAXOVA SYNDROME 2	Neu-Laxova Syndrome	GENOMICS_ENGLAND_DG	17436247, 25152457, 27475004		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEU-LAXOVA SYNDROME 2	Neu-Laxova Syndrome	UNIPROT_DG	25152457		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEU-LAXOVA SYNDROME 2	Neu-Laxova Syndrome	BEFREE	28222746		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NEU-LAXOVA SYNDROME 2	Neu-Laxova Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neuroblastoma	Neuroblastoma	Pubtator	18797883	Associate	★☆☆☆☆ Found in Text Mining only
Nocturia	Nocturia	BEFREE	27243216		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	26482881		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31810937		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29464033, 31234367, 31440861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	31234367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	18216146		★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	27489290		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31534629		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33291071, 40691196	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	37533289	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16950394, 21787114, 31171023		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22321069	Associate	★☆☆☆☆ Found in Text Mining only
Pachygyria	Pachygyria	HPO_DG			★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	12767274, 20180647		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31706267	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27277113		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28469572		★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	ORPHANET_DG	17436247		★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	UNIPROT_DG	17436247		★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	GENOMICS_ENGLAND_DG	17436247		★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	BEFREE	30122079		★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Phosphoserine Aminotransferase Deficiency	Phosphoserine aminotransferase deficiency	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Phosphoserine aminotransferase deficiency, infantile/juvenile form	Phosphoserine aminotransferase deficiency	Orphanet			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306	Associate	★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	32077105, 37627284, 37812589	Associate	★☆☆☆☆ Found in Text Mining only
Profound global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	28469572		★☆☆☆☆ Found in Text Mining only
Propionic acidemia	Propionic acidemia	BEFREE	31449969		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	10960844, 17957791		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10068342, 10098501, 10188912, 10223486, 10379797, 10547578, 10569618, 10652560, 10769689, 10792086, 11034093, 11212244, 11254449, 11507044, 11571582, 11857020, 11948967, 12023131, 12142373, 12142380, 12142383, 12218299, 12242725, 12471593, 12581210, 12735498, 12814669, 12858354, 12949428, 14572750, 14607215, 14743461, 14755677, 15036671, 15050332, 15154626, 15283888, 15322319, 15350307, 15368351, 15389792, 15474988, 15503828, 15543614, 15678150, 15705654, 15754351, 15911097, 15948728, 16000958, 16015610, 16043123, 16126332, 16172228, 16175585, 16381942, 16388501, 16516186, 16774685, 17012834, 17044040, 17151093, 17303324, 17320159, 17440964, 17467883, 17568188, 17629406, 17647201, 17957791, 17984071, 17991549, 18061337, 18076912, 18222179, 18225585, 18245536, 18361410, 18383875, 18431597, 18497063, 18627304, 18640109, 18646000, 18649734, 18697814, 18722876, 18757426, 18780294, 18801539, 18827812, 18836306, 18846227, 19013180, 19100308, 19116992, 19424173, 19434657, 19459176, 19462463, 19489685, 19507229, 19548854, 19575420, 19683515, 20065953, 20099974, 20180647, 20203524, 20302518, 20424135, 20451417, 20531306, 20632874, 20842666, 20860009, 20957673, 20967219, 20970419, 21095422, 21129724, 21160075, 21166744, 21212260, 21318478, 21345070, 21465221, 21520154, 21584487, 21600800, 21647377, 21788966, 21791629, 21813756, 21826098, 21939492, 21959049, 21969603, 21979296, 22019475, 22025344, 22047144, 22113713, 22154085, 22234006, 22281794, 22347450, 22528335, 22555040, 22576683, 22595052, 22642976, 22687565, 22703285, 22705054, 22765866, 22792137, 22820620, 23129512, 23213189, 23292082, 23318363, 23370768, 23381693, 23391636, 23433128, 23459097, 23464444, 23470460, 23527518, 23666742, 23737135, 23773345, 23792811, 23794398, 23826159, 23826841, 23861782, 23939133, 23958433, 24037955, 24120391, 24324057, 24338276, 24604720, 24627192, 24788382, 24820830, 24835310, 24849040, 24952954, 25101567, 25352524, 25422221, 25540025, 25563847, 25686826, 25750310, 25769446, 25876105, 25889691, 25891023, 25969992, 26068399, 26125925, 26134445, 26169045, 26171803, 26332453, 26339409, 26343558, 26345389, 26369530, 26431041, 26458958, 26614400, 26620456, 26689513, 26773531, 26782586, 26831660, 26847530, 26868935, 26871947, 26908062, 27038170, 27060154, 27076165, 27084245, 27102235, 27120785, 27121847, 27148956, 27189160, 27236302, 27289238, 27400876, 27460552, 27470540, 27481175, 27518576, 27522256, 27699819, 27718273, 27725729, 27726850, 27741522, 27741552, 27742670, 27775154, 27793023, 27803051, 27807905, 27818346, 27819756, 27824042, 27834470, 27871928, 27893706, 27897172, 27922627, 27987030, 27995937, 28045113, 28058757, 28081259, 28085790, 28094250, 28094251, 28117382, 28117387, 28121355, 28124523, 28124526, 28134773, 28138747, 28143868, 28157066, 28160549, 28162815, 28176139, 28283654, 28283782, 28291906, 28293631, 28296582, 28299763, 28322234, 28364014, 28376158, 28391870, 28399576, 28410987, 28416350, 28418195, 28431993, 28433413, 28464446, 28495148, 28524006, 28529650, 28534659, 28535696, 28558685, 28586946, 28607597, 28609648, 28615058, 28617988, 28621736, 28634111, 28679370, 28694142, 28695317, 28695916, 28701750, 28703328, 28715578, 28752596, 28762124, 28764970, 28767721, 28783264, 28791252, 28793236, 28795218, 28813037, 28841855, 28882030, 28882187, 28899491, 28905400, 28919101, 28923030, 28939158, 28948333, 28974201, 28981735, 28994485, 29020868, 29044297, 29044563, 29076912, 29084410, 29088771, 29099733, 29100363, 29105797, 29108322, 29122836, 29126446, 29129952, 29138196, 29149380, 29155186, 29156615, 29171259, 29184786, 29189229, 29203798, 29206164, 29232037, 29248950, 29260633, 29278842, 29284055, 29301143, 29304771, 29307509, 29308527, 29321194, 29322512, 29326690, 29339807, 29340038, 29372688, 29383739, 29386538, 29405172, 29416625, 29429895, 29434372, 29448139, 29454309, 29464033, 29465428, 29499730, 29499779, 29508048, 29518100, 29522280, 29523813, 29535815, 29570262, 29580912, 29588330, 29595681, 29617073, 29630104, 29630957, 29635526, 29650035, 29650325, 29659051, 29667616, 29686358, 29696637, 29745629, 29772100, 29781117, 29794067, 29797600, 29801018, 29803408, 29855276, 29885274, 29905907, 29970541, 29990335, 30002108, 30003374, 30012385, 30027591, 30031467, 30037211, 30041764, 30047547, 30049237, 30073682, 30105521, 30113755, 30121424, 30126402, 30171228, 30173421, 30176851, 30178243, 30179618, 30181389, 30186533, 30193693, 30209952, 30215656, 30222680, 30237027, 30265884, 30267820, 30284481, 30294801, 30301636, 30325021, 30325610, 30327584, 30334974, 30342844, 30365141, 30386737, 30388485, 30394930, 30470253, 30506128, 30538797, 30540597, 30564911, 30565302, 30592769, 30595465, 30617554, 30643974, 30653262, 30660434, 30679762, 30683712, 30767493, 30862227, 30868389, 30885050, 30890448, 30905464, 30917943, 30950457, 30958910, 30962017, 30972506, 30980038, 30989489, 30990112, 30996714, 31001481, 31004342, 31016435, 31045267, 31047912, 31090082, 31118771, 31122297, 31125365, 31128043, 31144489, 31156017, 31160348, 31166103, 31169140, 31172275, 31178436, 31190297, 31209634, 31261602, 31270961, 31284686, 31288722, 31305891, 31319390, 31338731, 31363165, 31392072, 31399825, 31421657, 31436568, 31446281, 31448239, 31454725, 31492993, 31502084, 31534629, 31534967, 31563066, 31588336, 31615476, 31628565, 31642740, 31690449, 31691526, 31695139, 31695844, 31711243, 31711524, 31711843, 31715513, 31722940, 31731188, 31733275, 31743339, 31749145, 31759363, 31766715, 31779677, 31780781, 31795990, 31808398, 31851457, 7524153, 7538236, 8543402, 8753736, 8968092, 9428387, 9989206		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	10068342, 19507229, 25686826, 31759363, 31786882		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	30341416		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19148481		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10881018, 15314219, 15761871, 18245536, 18542058, 19152342, 26369530, 28134773, 28674394, 29580912, 30155992		★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	28886262, 31218113		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	22298274		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31044493		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31570754		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	23381693, 27574819, 30797246		★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	HPO_DG			★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	15911097, 20302518, 23939133, 28380027, 28548372, 29249638, 29588330, 29808301, 30084276, 31414399, 8753736		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	39392257	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20955740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20955740		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Scott Syndrome	Scott Syndrome	BEFREE	27161080		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32077105	Associate	★☆☆☆☆ Found in Text Mining only
Spastic tetraparesis	Spastic tetraparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26316084, 27372650		★☆☆☆☆ Found in Text Mining only
Submucous cleft of hard palate	Submucosal cleft palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	31060755, 31266828		★☆☆☆☆ Found in Text Mining only
Talipes transversoplanus	Talipes Transversoplanus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	16950154		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27277113	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27277113	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	31004342		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24390667	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31630284		★☆☆☆☆ Found in Text Mining only
Trismus	Trismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	HPO_DG			★☆☆☆☆ Found in Text Mining only