Gene Gene information from NCBI Gene database.
Entrez ID 29964
Gene name Prickle planar cell polarity protein 4
Gene symbol PRICKLE4
Synonyms (NCBI Gene)
C6orf49OBTPOEBTTOMM6
Chromosome 6
Chromosome location 6p21.1
Summary C6ORF49 is a member of the LIM domain protein family (Teufel et al., 2005 [PubMed 15702247]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
183
miRTarBase ID miRNA Experiments Reference
MIRT046728 hsa-miR-222-3p CLASH 23622248
MIRT041605 hsa-miR-193b-3p CLASH 23622248
MIRT040154 hsa-miR-615-3p CLASH 23622248
MIRT691436 hsa-miR-3929 HITS-CLIP 23313552
MIRT691435 hsa-miR-4419b HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0003779 Function Actin binding IBA
GO:0005515 Function Protein binding IPI 33961781
GO:0005634 Component Nucleus NAS 15702247
GO:0005912 Component Adherens junction IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611389 16805 ENSG00000278224
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q2TBC4
Protein name Prickle-like protein 4 (Overexpressed breast tumor protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06297 PET 19 73 PET Domain Domain
PF00412 LIM 84 145 LIM domain Domain
PF00412 LIM 149 205 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a broad range of normal tissues as well as in hepatocellular carcinoma, breast cancer and prostate cancer tissues. {ECO:0000269|PubMed:15702247}.
Sequence
MSPQGPAVLSLGSLCLDTNQAPNWTGLQTLLQQLPPQDIDERYCLALGEEERAELQLFCA
RRKQEALGQGVAR
LVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACG
QALINLIYFYHDGQLYCGRHHAELL
RPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCA
GPLGGGRYALPGGSPCCPSCFENRY
SDAGSSWAGALEGQAFLGETGLDRTEGRDQTSVNS
ATLSRTLLAAAGGSSLQTQRGLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFS
TCSSSSDSEPEGFFLGERLPQSWKTPGSLQAEDSNASKTHCTMC
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Wnt signaling pathway  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 18507837
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 18507837 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 25032869
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 18507837
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of ovary Ovarian cancer BEFREE 25032869
★☆☆☆☆
Found in Text Mining only
ovarian neoplasm Ovarian neoplasm BEFREE 25032869
★☆☆☆☆
Found in Text Mining only