GYPE (glycophorin E (MNS blood group))

Gene

• Entrez ID: 2996
• Gene name: Glycophorin E (MNS blood group)
• Gene symbol: GYPE
• Synonyms (NCBI Gene): GPE, GYPA, MNS, MiIX
• Chromosome: 4
• Chromosome location: 4q31.21
• Summary: The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1038905	hsa-miR-142-5p	CLIP-seq
MIRT1038906	hsa-miR-340	CLIP-seq
MIRT1038907	hsa-miR-4481	CLIP-seq
MIRT1038908	hsa-miR-4658	CLIP-seq
MIRT1038909	hsa-miR-4745-5p	CLIP-seq
MIRT1038910	hsa-miR-4758-5p	CLIP-seq
MIRT1038911	hsa-miR-583	CLIP-seq
MIRT2240707	hsa-miR-1266	CLIP-seq
MIRT2240708	hsa-miR-2681	CLIP-seq
MIRT2240709	hsa-miR-337-3p	CLIP-seq
MIRT2240710	hsa-miR-3652	CLIP-seq
MIRT2240711	hsa-miR-3664-3p	CLIP-seq
MIRT2240712	hsa-miR-3680	CLIP-seq
MIRT2240713	hsa-miR-4430	CLIP-seq
MIRT2240714	hsa-miR-4505	CLIP-seq
MIRT2240715	hsa-miR-4518	CLIP-seq
MIRT2240716	hsa-miR-4646-5p	CLIP-seq
MIRT2240717	hsa-miR-4747-5p	CLIP-seq
MIRT2240718	hsa-miR-493	CLIP-seq
MIRT2240719	hsa-miR-562	CLIP-seq
MIRT2240720	hsa-miR-580	CLIP-seq
MIRT1038911	hsa-miR-583	CLIP-seq
MIRT2240721	hsa-miR-587	CLIP-seq
MIRT2388883	hsa-miR-139-5p	CLIP-seq
MIRT2240710	hsa-miR-3652	CLIP-seq
MIRT2388884	hsa-miR-4328	CLIP-seq
MIRT2240713	hsa-miR-4430	CLIP-seq
MIRT2240714	hsa-miR-4505	CLIP-seq
MIRT2388885	hsa-miR-450b-5p	CLIP-seq
MIRT2240716	hsa-miR-4646-5p	CLIP-seq
MIRT2240717	hsa-miR-4747-5p	CLIP-seq
MIRT2388886	hsa-miR-507	CLIP-seq
MIRT2388887	hsa-miR-557	CLIP-seq
MIRT2388888	hsa-miR-582-5p	CLIP-seq
MIRT2450908	hsa-miR-3692	CLIP-seq
MIRT2450909	hsa-miR-630	CLIP-seq
MIRT2544215	hsa-miR-1207-3p	CLIP-seq
MIRT2544216	hsa-miR-1301	CLIP-seq
MIRT2544217	hsa-miR-214	CLIP-seq
MIRT2544218	hsa-miR-3619-5p	CLIP-seq
MIRT2544219	hsa-miR-3665	CLIP-seq
MIRT2544220	hsa-miR-3925-5p	CLIP-seq
MIRT2544221	hsa-miR-3944-5p	CLIP-seq
MIRT2544222	hsa-miR-4660	CLIP-seq
MIRT2544223	hsa-miR-4773	CLIP-seq
MIRT2544224	hsa-miR-5047	CLIP-seq
MIRT2544225	hsa-miR-761	CLIP-seq
MIRT2544226	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	2295603, 7622054
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 138590
• HGNC: 4705
• e!Ensembl: ENSG00000197465

Protein

• UniProt ID: P15421
• Protein name: Glycophorin-E
• Protein function: This protein is a minor sialoglycoprotein in human erythrocyte membranes.
• Tissue specificity: TISSUE SPECIFICITY: Erythrocytes.
• Sequence:

  MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIF
  EVMLVVVGMIILISYCIR

• Sequence length: 78

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	23609441, 2779287, 31413099, 7762218		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8611443		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31302392		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	9266937	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	15145217, 30972754, 32987729	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30972754		★☆☆☆☆ Found in Text Mining only
Anterior segment mesenchymal dysgenesis	Anterior segment dysgenesis	BEFREE	6978612		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26637840		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26637840		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	6429031		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	9266937		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	10464655, 2916583		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	2916583	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26637840		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25523449		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	11146156	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	6576813		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	2677702, 2911598, 9856481		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	2911598	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	7158644		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	2582715, 27061008, 31286612		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	11171928		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21119205		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35955933	Associate	★☆☆☆☆ Found in Text Mining only
Catatonia, Malignant	Malignant Catatonia	BEFREE	28422845		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29361200		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21119205		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	7596357		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18406659		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	9291352		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	BEFREE	11680873		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1s	Congenital disorder of glycosylation	BEFREE	11680873		★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	BEFREE	7158644		★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	31685972		★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	BEFREE	29716529		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	2984105		★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	7386610		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	22189158, 3233232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	26637840, 3233232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	1612203, 49283		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	1612203, 49283		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33430853	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	33430853	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	15565952		★☆☆☆☆ Found in Text Mining only
Distal Renal Tubular Acidosis	Distal Renal Tubular Acidosis	BEFREE	9854053		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	12728455	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	2958722		★☆☆☆☆ Found in Text Mining only
Erythroblastosis, Fetal	Erythroblastosis Fetalis	BEFREE	2442890		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	10635999, 15822129, 7689157		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	15822129	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	10635999, 15822129, 7689157		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	31498071		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type I	Glycogen Storage Disease	BEFREE	23856420, 29802554		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	24386436, 24854378, 25448792, 25523449, 28029757, 28881107, 29180123, 29693324, 29716529		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	3254259		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	19392786		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	2185273, 9266937	Associate	★☆☆☆☆ Found in Text Mining only
Hemophagocytic Lymphohistiocytosis Familial 5	Hemophagocytic lymphohistiocytosis	Pubtator	26320718	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	18304844, 19438409		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11905993	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	9678591		★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	11171928		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	3498681		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29361200		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	31674261		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7521002, 7908079, 8611443		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	7689892	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	14521454	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1921460		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	9054641		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11254223		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	11254223	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21119205	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	2582715, 27061008, 31286612		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21119205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	17029826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	8794842		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15958596, 1778756, 18406659, 7689157, 7730060, 8319611, 8677297		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29063850, 29470692		★☆☆☆☆ Found in Text Mining only
Melnick-Needles Syndrome	Melnick-Needles Syndrome	BEFREE	20305604, 30027705		★☆☆☆☆ Found in Text Mining only
Menkes Kinky Hair Syndrome	Menkes Kinky Hair Syndrome	BEFREE	2597142		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	22189158, 3233232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	26637840, 3233232		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	31836952		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	21209359		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11830480	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16750852, 26469401, 9031614		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22160620	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	9266937	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	6576813		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	28543741		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30229394, 30912030		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28993014		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36571449	Associate	★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31483860		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30429042, 30797493, 31302392		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	11171928		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	28918161		★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	BEFREE	7158644		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	21237494	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35038288	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	9266937		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	17452518		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	12851693		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	17452518, 9475763	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21119205	Associate	★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	28918161		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	18430715		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	24419315		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	24419315	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	15565952		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	15565952	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15565952	Associate	★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	BEFREE	7158644		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	17029826		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	17029826		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15565952		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26239059	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	8794842		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	8794842		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25523449, 28918161, 29716529, 9031614		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34861826	Stimulate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	10811130, 9856481		★☆☆☆☆ Found in Text Mining only
X-linked sideroblastic anemia	Sideroblastic Anemia, X-Linked	BEFREE	1415186		★☆☆☆☆ Found in Text Mining only
Xanthoma	Xanthoma	BEFREE	28918161		★☆☆☆☆ Found in Text Mining only