CERS2 (ceramide synthase 2)

Gene

• Entrez ID: 29956
• Gene name: Ceramide synthase 2
• Gene symbol: CERS2
• Synonyms (NCBI Gene): L3, LASS2, SP260, TMSG1
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growt

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002754	hsa-miR-1-3p	Microarray	15685193
MIRT002726	hsa-miR-124-3p	Microarray	15685193
MIRT006917	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	22393241
MIRT006917	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	22393241
MIRT006917	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	22393241
MIRT006918	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	22393241
MIRT006918	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	22393241
MIRT021462	hsa-miR-9-5p	Microarray	17612493
MIRT021707	hsa-miR-133a-3p	Microarray	21396852
MIRT002726	hsa-miR-124-3p	Microarray	15685193
MIRT002726	hsa-miR-124-3p	Microarray	18668037
MIRT002754	hsa-miR-1-3p	Proteomics	18668040
MIRT002754	hsa-miR-1-3p	Microarray;Other	15685193
MIRT027344	hsa-miR-101-3p	Sequencing	20371350
MIRT028158	hsa-miR-93-5p	Sequencing	20371350
MIRT050621	hsa-miR-20a-5p	CLASH	23622248
MIRT039594	hsa-miR-625-5p	CLASH	23622248
MIRT039594	hsa-miR-625-5p	CLASH	23622248
MIRT507754	hsa-miR-548an	PAR-CLIP	20371350
MIRT507753	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT507752	hsa-miR-4484	PAR-CLIP	20371350
MIRT507750	hsa-miR-3929	PAR-CLIP	20371350
MIRT507749	hsa-miR-4419b	PAR-CLIP	20371350
MIRT507748	hsa-miR-4478	PAR-CLIP	20371350
MIRT507747	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT507742	hsa-miR-6776-5p	PAR-CLIP	20371350
MIRT507739	hsa-miR-299-5p	PAR-CLIP	20371350
MIRT507738	hsa-miR-4504	PAR-CLIP	20371350
MIRT507736	hsa-miR-1262	PAR-CLIP	20371350
MIRT507735	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT507734	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT568061	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT507733	hsa-miR-659-3p	PAR-CLIP	20371350
MIRT507754	hsa-miR-548an	PAR-CLIP	23446348
MIRT507753	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT507752	hsa-miR-4484	PAR-CLIP	23446348
MIRT507751	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT507750	hsa-miR-3929	PAR-CLIP	23446348
MIRT507749	hsa-miR-4419b	PAR-CLIP	23446348
MIRT507748	hsa-miR-4478	PAR-CLIP	23446348
MIRT507747	hsa-miR-5002-5p	PAR-CLIP	23446348
MIRT507746	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT507745	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507744	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507743	hsa-miR-8089	PAR-CLIP	23446348
MIRT507742	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT507741	hsa-miR-5191	PAR-CLIP	23446348
MIRT507740	hsa-miR-4450	PAR-CLIP	23446348
MIRT507739	hsa-miR-299-5p	PAR-CLIP	23446348
MIRT507738	hsa-miR-4504	PAR-CLIP	23446348
MIRT507737	hsa-miR-6857-5p	PAR-CLIP	23446348
MIRT507736	hsa-miR-1262	PAR-CLIP	23446348
MIRT507735	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT507734	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT507733	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT002754	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT479333	hsa-miR-206	PAR-CLIP	23592263
MIRT479332	hsa-miR-613	PAR-CLIP	23592263
MIRT479331	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479330	hsa-miR-8066	PAR-CLIP	23592263
MIRT479329	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT479328	hsa-miR-5195-5p	PAR-CLIP	23592263
MIRT479327	hsa-miR-4330	PAR-CLIP	23592263
MIRT479326	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT479325	hsa-miR-219a-2-3p	PAR-CLIP	23592263
MIRT479324	hsa-miR-1257	PAR-CLIP	23592263
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT028158	hsa-miR-93-5p	Western blot	27099514
MIRT039594	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT039594	hsa-miR-625-5p	PAR-CLIP	27292025
MIRT507754	hsa-miR-548an	PAR-CLIP	20371350
MIRT507753	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT507752	hsa-miR-4484	PAR-CLIP	20371350
MIRT507750	hsa-miR-3929	PAR-CLIP	20371350
MIRT507749	hsa-miR-4419b	PAR-CLIP	20371350
MIRT507748	hsa-miR-4478	PAR-CLIP	20371350
MIRT507747	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT507742	hsa-miR-6776-5p	PAR-CLIP	20371350
MIRT507739	hsa-miR-299-5p	PAR-CLIP	20371350
MIRT507738	hsa-miR-4504	PAR-CLIP	20371350
MIRT507736	hsa-miR-1262	PAR-CLIP	20371350
MIRT507735	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT507734	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT568061	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT507733	hsa-miR-659-3p	PAR-CLIP	20371350
MIRT507754	hsa-miR-548an	PAR-CLIP	23446348
MIRT507753	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT507752	hsa-miR-4484	PAR-CLIP	23446348
MIRT507751	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT507750	hsa-miR-3929	PAR-CLIP	23446348
MIRT507749	hsa-miR-4419b	PAR-CLIP	23446348
MIRT507748	hsa-miR-4478	PAR-CLIP	23446348
MIRT507747	hsa-miR-5002-5p	PAR-CLIP	23446348
MIRT507746	hsa-miR-6852-5p	PAR-CLIP	23446348
MIRT507745	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507744	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507743	hsa-miR-8089	PAR-CLIP	23446348
MIRT507742	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT507741	hsa-miR-5191	PAR-CLIP	23446348
MIRT507740	hsa-miR-4450	PAR-CLIP	23446348
MIRT507739	hsa-miR-299-5p	PAR-CLIP	23446348
MIRT507738	hsa-miR-4504	PAR-CLIP	23446348
MIRT507737	hsa-miR-6857-5p	PAR-CLIP	23446348
MIRT507736	hsa-miR-1262	PAR-CLIP	23446348
MIRT507735	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT507734	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT507733	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT002754	hsa-miR-1-3p	PAR-CLIP	23592263
MIRT479333	hsa-miR-206	PAR-CLIP	23592263
MIRT479332	hsa-miR-613	PAR-CLIP	23592263
MIRT479331	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479330	hsa-miR-8066	PAR-CLIP	23592263
MIRT479329	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT479328	hsa-miR-5195-5p	PAR-CLIP	23592263
MIRT479327	hsa-miR-4330	PAR-CLIP	23592263
MIRT479326	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT479325	hsa-miR-219a-2-3p	PAR-CLIP	23592263
MIRT479324	hsa-miR-1257	PAR-CLIP	23592263
MIRT886835	hsa-let-7a	CLIP-seq
MIRT886836	hsa-let-7b	CLIP-seq
MIRT886837	hsa-let-7c	CLIP-seq
MIRT886838	hsa-let-7d	CLIP-seq
MIRT886839	hsa-let-7e	CLIP-seq
MIRT886840	hsa-let-7f	CLIP-seq
MIRT886841	hsa-let-7g	CLIP-seq
MIRT886842	hsa-let-7i	CLIP-seq
MIRT886843	hsa-miR-101	CLIP-seq
MIRT886844	hsa-miR-106a	CLIP-seq
MIRT886845	hsa-miR-106b	CLIP-seq
MIRT886846	hsa-miR-1207-3p	CLIP-seq
MIRT886847	hsa-miR-124	CLIP-seq
MIRT886848	hsa-miR-1271	CLIP-seq
MIRT886849	hsa-miR-1273d	CLIP-seq
MIRT886850	hsa-miR-1302	CLIP-seq
MIRT886851	hsa-miR-132	CLIP-seq
MIRT886852	hsa-miR-1321	CLIP-seq
MIRT886853	hsa-miR-133a	CLIP-seq
MIRT886854	hsa-miR-133b	CLIP-seq
MIRT886855	hsa-miR-149	CLIP-seq
MIRT886856	hsa-miR-17	CLIP-seq
MIRT886857	hsa-miR-182	CLIP-seq
MIRT886858	hsa-miR-203	CLIP-seq
MIRT886859	hsa-miR-20a	CLIP-seq
MIRT886860	hsa-miR-20b	CLIP-seq
MIRT886861	hsa-miR-212	CLIP-seq
MIRT886862	hsa-miR-2355-5p	CLIP-seq
MIRT886863	hsa-miR-2467-3p	CLIP-seq
MIRT886864	hsa-miR-2682	CLIP-seq
MIRT886865	hsa-miR-3064-5p	CLIP-seq
MIRT886866	hsa-miR-3119	CLIP-seq
MIRT886867	hsa-miR-3135b	CLIP-seq
MIRT886868	hsa-miR-3136-3p	CLIP-seq
MIRT886869	hsa-miR-3145-5p	CLIP-seq
MIRT886870	hsa-miR-3146	CLIP-seq
MIRT886871	hsa-miR-3162-5p	CLIP-seq
MIRT886872	hsa-miR-3176	CLIP-seq
MIRT886873	hsa-miR-3183	CLIP-seq
MIRT886874	hsa-miR-3189-3p	CLIP-seq
MIRT886875	hsa-miR-3192	CLIP-seq
MIRT886876	hsa-miR-3609	CLIP-seq
MIRT886877	hsa-miR-3614-3p	CLIP-seq
MIRT886878	hsa-miR-3662	CLIP-seq
MIRT886879	hsa-miR-3679-3p	CLIP-seq
MIRT886880	hsa-miR-3689a-3p	CLIP-seq
MIRT886881	hsa-miR-3689c	CLIP-seq
MIRT886882	hsa-miR-3689d	CLIP-seq
MIRT886883	hsa-miR-3714	CLIP-seq
MIRT886884	hsa-miR-376a	CLIP-seq
MIRT886885	hsa-miR-376b	CLIP-seq
MIRT886886	hsa-miR-3910	CLIP-seq
MIRT886887	hsa-miR-3922-3p	CLIP-seq
MIRT886888	hsa-miR-3926	CLIP-seq
MIRT886889	hsa-miR-3943	CLIP-seq
MIRT886890	hsa-miR-4257	CLIP-seq
MIRT886891	hsa-miR-4267	CLIP-seq
MIRT886892	hsa-miR-4270	CLIP-seq
MIRT886893	hsa-miR-4274	CLIP-seq
MIRT886894	hsa-miR-4279	CLIP-seq
MIRT886895	hsa-miR-4281	CLIP-seq
MIRT886896	hsa-miR-4286	CLIP-seq
MIRT886897	hsa-miR-4298	CLIP-seq
MIRT886898	hsa-miR-4300	CLIP-seq
MIRT886899	hsa-miR-4314	CLIP-seq
MIRT886900	hsa-miR-4419a	CLIP-seq
MIRT886901	hsa-miR-4441	CLIP-seq
MIRT886902	hsa-miR-4446-5p	CLIP-seq
MIRT886903	hsa-miR-4458	CLIP-seq
MIRT886904	hsa-miR-4470	CLIP-seq
MIRT886905	hsa-miR-449c	CLIP-seq
MIRT886906	hsa-miR-4500	CLIP-seq
MIRT886907	hsa-miR-4510	CLIP-seq
MIRT886908	hsa-miR-455-5p	CLIP-seq
MIRT886909	hsa-miR-4646-5p	CLIP-seq
MIRT886910	hsa-miR-4659a-5p	CLIP-seq
MIRT886911	hsa-miR-4659b-5p	CLIP-seq
MIRT886912	hsa-miR-4667-3p	CLIP-seq
MIRT886913	hsa-miR-4712-5p	CLIP-seq
MIRT886914	hsa-miR-4723-3p	CLIP-seq
MIRT886915	hsa-miR-4725-5p	CLIP-seq
MIRT886916	hsa-miR-4728-5p	CLIP-seq
MIRT886917	hsa-miR-4731-5p	CLIP-seq
MIRT886918	hsa-miR-4739	CLIP-seq
MIRT886919	hsa-miR-4756-5p	CLIP-seq
MIRT886920	hsa-miR-4760-3p	CLIP-seq
MIRT886921	hsa-miR-4766-5p	CLIP-seq
MIRT886922	hsa-miR-4776-3p	CLIP-seq
MIRT886923	hsa-miR-4781-5p	CLIP-seq
MIRT886924	hsa-miR-4794	CLIP-seq
MIRT886925	hsa-miR-4796-3p	CLIP-seq
MIRT886926	hsa-miR-491-3p	CLIP-seq
MIRT886927	hsa-miR-502-5p	CLIP-seq
MIRT886928	hsa-miR-504	CLIP-seq
MIRT886929	hsa-miR-506	CLIP-seq
MIRT886930	hsa-miR-508-5p	CLIP-seq
MIRT886931	hsa-miR-516b	CLIP-seq
MIRT886932	hsa-miR-519d	CLIP-seq
MIRT886933	hsa-miR-522	CLIP-seq
MIRT886934	hsa-miR-548aa	CLIP-seq
MIRT886935	hsa-miR-548ac	CLIP-seq
MIRT886936	hsa-miR-548ah	CLIP-seq
MIRT886937	hsa-miR-548c-3p	CLIP-seq
MIRT886938	hsa-miR-548d-3p	CLIP-seq
MIRT886939	hsa-miR-548v	CLIP-seq
MIRT886940	hsa-miR-548z	CLIP-seq
MIRT886941	hsa-miR-555	CLIP-seq
MIRT886942	hsa-miR-562	CLIP-seq
MIRT886943	hsa-miR-579	CLIP-seq
MIRT886944	hsa-miR-586	CLIP-seq
MIRT886945	hsa-miR-592	CLIP-seq
MIRT886946	hsa-miR-597	CLIP-seq
MIRT886947	hsa-miR-599	CLIP-seq
MIRT886948	hsa-miR-601	CLIP-seq
MIRT886949	hsa-miR-615-3p	CLIP-seq
MIRT886950	hsa-miR-621	CLIP-seq
MIRT886951	hsa-miR-642a	CLIP-seq
MIRT886952	hsa-miR-659	CLIP-seq
MIRT886953	hsa-miR-660	CLIP-seq
MIRT886954	hsa-miR-664	CLIP-seq
MIRT886955	hsa-miR-760	CLIP-seq
MIRT886956	hsa-miR-770-5p	CLIP-seq
MIRT886957	hsa-miR-9	CLIP-seq
MIRT886958	hsa-miR-920	CLIP-seq
MIRT886959	hsa-miR-93	CLIP-seq
MIRT886960	hsa-miR-96	CLIP-seq
MIRT886961	hsa-miR-98	CLIP-seq
MIRT886847	hsa-miR-124	CLIP-seq
MIRT886848	hsa-miR-1271	CLIP-seq
MIRT886850	hsa-miR-1302	CLIP-seq
MIRT886852	hsa-miR-1321	CLIP-seq
MIRT886857	hsa-miR-182	CLIP-seq
MIRT886962	hsa-miR-3605-5p	CLIP-seq
MIRT886883	hsa-miR-3714	CLIP-seq
MIRT886886	hsa-miR-3910	CLIP-seq
MIRT886897	hsa-miR-4298	CLIP-seq
MIRT886900	hsa-miR-4419a	CLIP-seq
MIRT886907	hsa-miR-4510	CLIP-seq
MIRT886918	hsa-miR-4739	CLIP-seq
MIRT886919	hsa-miR-4756-5p	CLIP-seq
MIRT886963	hsa-miR-4779	CLIP-seq
MIRT886929	hsa-miR-506	CLIP-seq
MIRT886952	hsa-miR-659	CLIP-seq
MIRT886960	hsa-miR-96	CLIP-seq
MIRT1963006	hsa-miR-1	CLIP-seq
MIRT886846	hsa-miR-1207-3p	CLIP-seq
MIRT886847	hsa-miR-124	CLIP-seq
MIRT886848	hsa-miR-1271	CLIP-seq
MIRT886852	hsa-miR-1321	CLIP-seq
MIRT886853	hsa-miR-133a	CLIP-seq
MIRT886854	hsa-miR-133b	CLIP-seq
MIRT1963007	hsa-miR-137	CLIP-seq
MIRT1963008	hsa-miR-146a	CLIP-seq
MIRT1963009	hsa-miR-146b-5p	CLIP-seq
MIRT886855	hsa-miR-149	CLIP-seq
MIRT886857	hsa-miR-182	CLIP-seq
MIRT886858	hsa-miR-203	CLIP-seq
MIRT1963010	hsa-miR-219-2-3p	CLIP-seq
MIRT886862	hsa-miR-2355-5p	CLIP-seq
MIRT886863	hsa-miR-2467-3p	CLIP-seq
MIRT1963011	hsa-miR-2964a-3p	CLIP-seq
MIRT1963012	hsa-miR-3117-5p	CLIP-seq
MIRT886868	hsa-miR-3136-3p	CLIP-seq
MIRT886869	hsa-miR-3145-5p	CLIP-seq
MIRT886870	hsa-miR-3146	CLIP-seq
MIRT1963013	hsa-miR-3162-3p	CLIP-seq
MIRT886871	hsa-miR-3162-5p	CLIP-seq
MIRT886962	hsa-miR-3605-5p	CLIP-seq
MIRT886877	hsa-miR-3614-3p	CLIP-seq
MIRT886878	hsa-miR-3662	CLIP-seq
MIRT1963014	hsa-miR-3678-3p	CLIP-seq
MIRT886883	hsa-miR-3714	CLIP-seq
MIRT886886	hsa-miR-3910	CLIP-seq
MIRT1963015	hsa-miR-3925-5p	CLIP-seq
MIRT886888	hsa-miR-3926	CLIP-seq
MIRT886889	hsa-miR-3943	CLIP-seq
MIRT886891	hsa-miR-4267	CLIP-seq
MIRT886892	hsa-miR-4270	CLIP-seq
MIRT886893	hsa-miR-4274	CLIP-seq
MIRT886895	hsa-miR-4281	CLIP-seq
MIRT886896	hsa-miR-4286	CLIP-seq
MIRT886898	hsa-miR-4300	CLIP-seq
MIRT1963016	hsa-miR-4307	CLIP-seq
MIRT886900	hsa-miR-4419a	CLIP-seq
MIRT886901	hsa-miR-4441	CLIP-seq
MIRT886904	hsa-miR-4470	CLIP-seq
MIRT886907	hsa-miR-4510	CLIP-seq
MIRT886910	hsa-miR-4659a-5p	CLIP-seq
MIRT886911	hsa-miR-4659b-5p	CLIP-seq
MIRT1963017	hsa-miR-4680-5p	CLIP-seq
MIRT886913	hsa-miR-4712-5p	CLIP-seq
MIRT1963018	hsa-miR-4716-5p	CLIP-seq
MIRT886917	hsa-miR-4731-5p	CLIP-seq
MIRT886918	hsa-miR-4739	CLIP-seq
MIRT886919	hsa-miR-4756-5p	CLIP-seq
MIRT886922	hsa-miR-4776-3p	CLIP-seq
MIRT886963	hsa-miR-4779	CLIP-seq
MIRT886929	hsa-miR-506	CLIP-seq
MIRT886930	hsa-miR-508-5p	CLIP-seq
MIRT886931	hsa-miR-516b	CLIP-seq
MIRT886933	hsa-miR-522	CLIP-seq
MIRT886942	hsa-miR-562	CLIP-seq
MIRT886948	hsa-miR-601	CLIP-seq
MIRT886949	hsa-miR-615-3p	CLIP-seq
MIRT1963019	hsa-miR-619	CLIP-seq
MIRT886950	hsa-miR-621	CLIP-seq
MIRT1963020	hsa-miR-625	CLIP-seq
MIRT886951	hsa-miR-642a	CLIP-seq
MIRT886952	hsa-miR-659	CLIP-seq
MIRT886955	hsa-miR-760	CLIP-seq
MIRT886956	hsa-miR-770-5p	CLIP-seq
MIRT1963021	hsa-miR-889	CLIP-seq
MIRT886958	hsa-miR-920	CLIP-seq
MIRT886960	hsa-miR-96	CLIP-seq
MIRT886892	hsa-miR-4270	CLIP-seq
MIRT886901	hsa-miR-4441	CLIP-seq
MIRT886835	hsa-let-7a	CLIP-seq
MIRT886836	hsa-let-7b	CLIP-seq
MIRT886837	hsa-let-7c	CLIP-seq
MIRT886838	hsa-let-7d	CLIP-seq
MIRT886839	hsa-let-7e	CLIP-seq
MIRT886840	hsa-let-7f	CLIP-seq
MIRT886841	hsa-let-7g	CLIP-seq
MIRT886842	hsa-let-7i	CLIP-seq
MIRT886844	hsa-miR-106a	CLIP-seq
MIRT886845	hsa-miR-106b	CLIP-seq
MIRT886846	hsa-miR-1207-3p	CLIP-seq
MIRT886847	hsa-miR-124	CLIP-seq
MIRT886848	hsa-miR-1271	CLIP-seq
MIRT886852	hsa-miR-1321	CLIP-seq
MIRT886853	hsa-miR-133a	CLIP-seq
MIRT886854	hsa-miR-133b	CLIP-seq
MIRT886855	hsa-miR-149	CLIP-seq
MIRT886856	hsa-miR-17	CLIP-seq
MIRT886857	hsa-miR-182	CLIP-seq
MIRT886859	hsa-miR-20a	CLIP-seq
MIRT886860	hsa-miR-20b	CLIP-seq
MIRT886862	hsa-miR-2355-5p	CLIP-seq
MIRT886863	hsa-miR-2467-3p	CLIP-seq
MIRT886866	hsa-miR-3119	CLIP-seq
MIRT886867	hsa-miR-3135b	CLIP-seq
MIRT1963013	hsa-miR-3162-3p	CLIP-seq
MIRT886871	hsa-miR-3162-5p	CLIP-seq
MIRT886874	hsa-miR-3189-3p	CLIP-seq
MIRT886875	hsa-miR-3192	CLIP-seq
MIRT886876	hsa-miR-3609	CLIP-seq
MIRT886877	hsa-miR-3614-3p	CLIP-seq
MIRT886879	hsa-miR-3679-3p	CLIP-seq
MIRT886880	hsa-miR-3689a-3p	CLIP-seq
MIRT886881	hsa-miR-3689c	CLIP-seq
MIRT886882	hsa-miR-3689d	CLIP-seq
MIRT886883	hsa-miR-3714	CLIP-seq
MIRT886886	hsa-miR-3910	CLIP-seq
MIRT886889	hsa-miR-3943	CLIP-seq
MIRT2199437	hsa-miR-410	CLIP-seq
MIRT886890	hsa-miR-4257	CLIP-seq
MIRT886891	hsa-miR-4267	CLIP-seq
MIRT886892	hsa-miR-4270	CLIP-seq
MIRT886894	hsa-miR-4279	CLIP-seq
MIRT886896	hsa-miR-4286	CLIP-seq
MIRT886899	hsa-miR-4314	CLIP-seq
MIRT886901	hsa-miR-4441	CLIP-seq
MIRT886902	hsa-miR-4446-5p	CLIP-seq
MIRT886903	hsa-miR-4458	CLIP-seq
MIRT886904	hsa-miR-4470	CLIP-seq
MIRT886906	hsa-miR-4500	CLIP-seq
MIRT886908	hsa-miR-455-5p	CLIP-seq
MIRT886909	hsa-miR-4646-5p	CLIP-seq
MIRT886913	hsa-miR-4712-5p	CLIP-seq
MIRT886915	hsa-miR-4725-5p	CLIP-seq
MIRT886916	hsa-miR-4728-5p	CLIP-seq
MIRT886918	hsa-miR-4739	CLIP-seq
MIRT886919	hsa-miR-4756-5p	CLIP-seq
MIRT886923	hsa-miR-4781-5p	CLIP-seq
MIRT886925	hsa-miR-4796-3p	CLIP-seq
MIRT886926	hsa-miR-491-3p	CLIP-seq
MIRT886927	hsa-miR-502-5p	CLIP-seq
MIRT886928	hsa-miR-504	CLIP-seq
MIRT886929	hsa-miR-506	CLIP-seq
MIRT886931	hsa-miR-516b	CLIP-seq
MIRT886932	hsa-miR-519d	CLIP-seq
MIRT886936	hsa-miR-548ah	CLIP-seq
MIRT886941	hsa-miR-555	CLIP-seq
MIRT886944	hsa-miR-586	CLIP-seq
MIRT1963019	hsa-miR-619	CLIP-seq
MIRT2199438	hsa-miR-633	CLIP-seq
MIRT886952	hsa-miR-659	CLIP-seq
MIRT886955	hsa-miR-760	CLIP-seq
MIRT886956	hsa-miR-770-5p	CLIP-seq
MIRT886959	hsa-miR-93	CLIP-seq
MIRT886960	hsa-miR-96	CLIP-seq
MIRT886961	hsa-miR-98	CLIP-seq
MIRT886874	hsa-miR-3189-3p	CLIP-seq
MIRT886892	hsa-miR-4270	CLIP-seq
MIRT886901	hsa-miR-4441	CLIP-seq
MIRT886927	hsa-miR-502-5p	CLIP-seq
MIRT886931	hsa-miR-516b	CLIP-seq
MIRT886955	hsa-miR-760	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KLF6	Activation	22169644
SP1	Activation	22169644

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11543633, 20195357, 20937905, 21988832, 32296183, 32911434, 33961781
GO:0005783	Component	Endoplasmic reticulum	IDA	18165233
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0010626	Process	Negative regulation of Schwann cell proliferation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016410	Function	N-acyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030148	Process	Sphingolipid biosynthetic process	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0035902	Process	Response to immobilization stress	IEA
GO:0046513	Process	Ceramide biosynthetic process	IBA
GO:0046513	Process	Ceramide biosynthetic process	IDA	17977534, 18165233, 29632068
GO:0046513	Process	Ceramide biosynthetic process	IEA
GO:0046513	Process	Ceramide biosynthetic process	IEA
GO:0048681	Process	Negative regulation of axon regeneration	IEA
GO:0048681	Process	Negative regulation of axon regeneration	ISS
GO:0050291	Function	Sphingosine N-acyltransferase activity	IBA
GO:0050291	Function	Sphingosine N-acyltransferase activity	IDA	17977534, 18165233, 29632068
GO:0050291	Function	Sphingosine N-acyltransferase activity	IEA
GO:0050291	Function	Sphingosine N-acyltransferase activity	TAS
GO:1900148	Process	Negative regulation of Schwann cell migration	IEA
GO:1900148	Process	Negative regulation of Schwann cell migration	ISS
GO:1905045	Process	Negative regulation of Schwann cell proliferation involved in axon regeneration	IEA
GO:1905045	Process	Negative regulation of Schwann cell proliferation involved in axon regeneration	ISS

Other IDs

• MIM: 606920
• HGNC: 14076
• e!Ensembl: ENSG00000143418

Protein

• UniProt ID: Q96G23
• Protein name: Ceramide synthase 2 (CerS2) (LAG1 longevity assurance homolog 2) (SP260) (Sphingosine N-acyltransferase CERS2) (EC 2.3.1.24) (Tumor metastasis-suppressor gene 1 protein) (Very-long-chain ceramide synthase CERS2) (EC 2.3.1.297)
• Protein function: Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27) (PubMed:17977534, PubMed:18165233, PubMed:18541923, PubMed:1972
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	70 → 127	Homeodomain	Domain
  PF03798	TRAM_LAG1_CLN8	132 → 325	TLC domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney, liver, brain, heart, placenta and lung. {ECO:0000269|PubMed:11543633}.
• Sequence:

  MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV
  ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR
  RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY
  WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD
  SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
  GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA
  KSRPLANGHPILNNNHRKND

• Sequence length: 380

Pathways

KEGG:

Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway

Reactome:

Sphingolipid de novo biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEGMATOGENOUS RETINAL DETACHMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	35454332	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	32661301	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21755371, 26150338, 29581781, 30213291, 30463687, 30898713, 31577563, 31636736		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19912991, 22230369, 22580606, 25213553, 25501280, 25973015, 26110566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25501280	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25973015, 33568634	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21755371, 30213291		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27581744	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21755371, 26150338, 29581781, 30213291, 30463687, 30898713, 31577563, 31636736		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34915026	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25238615		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20383146		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28699686		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37298446	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25238615		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25238615		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25238615	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	24453046		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29626628		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24706805		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24706805	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24706805		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	33568634	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29720183		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28699686		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34915026	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19912991, 22230369, 22580606, 25213553, 25501280, 25973015, 26110566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22573553, 22991218, 24453046, 25501280, 29138865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21755371, 26150338, 29581781, 30213291, 30463687, 30898713, 31577563, 31636736		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25501280, 29581781, 30988071		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21926416		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21926416	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25697397		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21928351, 25501280, 30213291, 30537159, 31636736		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31676768		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30302058		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22573553, 22991218, 24453046, 25501280, 29138865		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25501280	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	GWASDB_DG	23585552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	GWASCAT_DG	23585552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	25295789, 29626628		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26150338, 31636736	Associate	★☆☆☆☆ Found in Text Mining only