OSGIN1 (oxidative stress induced growth inhibitor 1)

Gene

• Entrez ID: 29948
• Gene name: Oxidative stress induced growth inhibitor 1
• Gene symbol: OSGIN1
• Synonyms (NCBI Gene): BDGI, OKL38
• Chromosome: 16
• Chromosome location: 16q23.3
• Summary: This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1206627	hsa-miR-1205	CLIP-seq
MIRT1206628	hsa-miR-1299	CLIP-seq
MIRT1206629	hsa-miR-3202	CLIP-seq
MIRT1206630	hsa-miR-4446-3p	CLIP-seq
MIRT1206631	hsa-miR-4533	CLIP-seq
MIRT1206632	hsa-miR-4782-5p	CLIP-seq
MIRT1206633	hsa-miR-516b	CLIP-seq
MIRT1206634	hsa-miR-524-3p	CLIP-seq
MIRT1206635	hsa-miR-525-3p	CLIP-seq
MIRT1206636	hsa-miR-875-3p	CLIP-seq
MIRT1206637	hsa-miR-1266	CLIP-seq
MIRT1206638	hsa-miR-2861	CLIP-seq
MIRT1206639	hsa-miR-3127-5p	CLIP-seq
MIRT1206640	hsa-miR-3183	CLIP-seq
MIRT1206641	hsa-miR-3192	CLIP-seq
MIRT1206642	hsa-miR-3664-3p	CLIP-seq
MIRT1206643	hsa-miR-3909	CLIP-seq
MIRT1206644	hsa-miR-3918	CLIP-seq
MIRT1206645	hsa-miR-4300	CLIP-seq
MIRT1206646	hsa-miR-4512	CLIP-seq
MIRT1206647	hsa-miR-4518	CLIP-seq
MIRT1206648	hsa-miR-4723-3p	CLIP-seq
MIRT1206649	hsa-miR-661	CLIP-seq
MIRT1206650	hsa-miR-920	CLIP-seq
MIRT1206651	hsa-miR-4417	CLIP-seq
MIRT1206652	hsa-miR-4753-5p	CLIP-seq
MIRT2287832	hsa-miR-450b-3p	CLIP-seq
MIRT2287833	hsa-miR-4713-3p	CLIP-seq
MIRT2287834	hsa-miR-638	CLIP-seq
MIRT2287835	hsa-miR-769-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25640309, 31515488, 32296183
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	11459809
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IBA
GO:0030308	Process	Negative regulation of cell growth	IDA	11459809
GO:0030496	Component	Midbody	IEA

Other IDs

• MIM: 607975
• HGNC: 30093
• e!Ensembl: ENSG00000140961

Protein

• UniProt ID: Q9UJX0
• Protein name: Oxidative stress-induced growth inhibitor 1 (EC 1.14.13.-) (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38)
• Protein function: Monooxygenase catalytic activity (PubMed:38442170). Involved in regulation of cytokinesis; promotes RHOA activity, probably acting locally at the midbody in late cytokinesis (PubMed:38442170). Monooxygenase activity is involved in stabilizing tr
• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver (PubMed:11459809, PubMed:14570898). {ECO:0000269|PubMed:11459809, ECO:0000269|PubMed:14570898}.
• Sequence:

  MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
  PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
  VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
  DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
  NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
  VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
  LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
  SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP

• Sequence length: 477

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	24434148		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24434148		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24434148	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11459809, 15569677, 16924236, 28807874		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14570898	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14570898	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	14570898, 16924236		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	14570898	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16924236, 24417816		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16924236		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37646890	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11459809, 15569677, 16924236, 28807874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	14570898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	16924236		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14570898		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15569677		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	23209447		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11459809, 14570898, 24417816, 24434148, 28807874		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	14570898		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38600165	Associate	★☆☆☆☆ Found in Text Mining only