Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29943
Gene name	Peptidyl arginine deiminase 1
Gene symbol	PADI1
Synonyms (NCBI Gene)	HPAD10PAD1PDIPDI1
Chromosome	1
Chromosome location	1p36.13
Summary	This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distin

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437609	hsa-miR-145-5p	MicroarrayqRT-PCR	22815788
MIRT495720	hsa-miR-3929	PAR-CLIP	22291592
MIRT495719	hsa-miR-4419b	PAR-CLIP	22291592
MIRT495718	hsa-miR-4478	PAR-CLIP	22291592
MIRT495717	hsa-miR-6755-5p	PAR-CLIP	22291592
MIRT495716	hsa-miR-1296-3p	PAR-CLIP	22291592
MIRT495715	hsa-miR-194-3p	PAR-CLIP	22291592
MIRT495714	hsa-miR-5580-5p	PAR-CLIP	22291592
MIRT495713	hsa-miR-6077	PAR-CLIP	22291592
MIRT495712	hsa-miR-4271	PAR-CLIP	22291592
MIRT495711	hsa-miR-4725-3p	PAR-CLIP	22291592
MIRT495710	hsa-miR-6780b-5p	PAR-CLIP	22291592
MIRT495709	hsa-miR-625-5p	PAR-CLIP	22291592
MIRT495708	hsa-miR-4723-5p	PAR-CLIP	22291592
MIRT495707	hsa-miR-5698	PAR-CLIP	22291592
MIRT495706	hsa-miR-6870-5p	PAR-CLIP	22291592
MIRT495705	hsa-miR-7111-5p	PAR-CLIP	22291592
MIRT495704	hsa-miR-4525	PAR-CLIP	22291592
MIRT495703	hsa-miR-5010-5p	PAR-CLIP	22291592
MIRT495702	hsa-miR-4447	PAR-CLIP	22291592
MIRT495701	hsa-miR-4472	PAR-CLIP	22291592
MIRT495700	hsa-miR-1275	PAR-CLIP	22291592
MIRT495699	hsa-miR-4665-5p	PAR-CLIP	22291592
MIRT495720	hsa-miR-3929	PAR-CLIP	22291592
MIRT495719	hsa-miR-4419b	PAR-CLIP	22291592
MIRT495718	hsa-miR-4478	PAR-CLIP	22291592
MIRT495717	hsa-miR-6755-5p	PAR-CLIP	22291592
MIRT495716	hsa-miR-1296-3p	PAR-CLIP	22291592
MIRT495715	hsa-miR-194-3p	PAR-CLIP	22291592
MIRT495714	hsa-miR-5580-5p	PAR-CLIP	22291592
MIRT495713	hsa-miR-6077	PAR-CLIP	22291592
MIRT495712	hsa-miR-4271	PAR-CLIP	22291592
MIRT495711	hsa-miR-4725-3p	PAR-CLIP	22291592
MIRT495710	hsa-miR-6780b-5p	PAR-CLIP	22291592
MIRT495709	hsa-miR-625-5p	PAR-CLIP	22291592
MIRT495708	hsa-miR-4723-5p	PAR-CLIP	22291592
MIRT495707	hsa-miR-5698	PAR-CLIP	22291592
MIRT495706	hsa-miR-6870-5p	PAR-CLIP	22291592
MIRT495705	hsa-miR-7111-5p	PAR-CLIP	22291592
MIRT495704	hsa-miR-4525	PAR-CLIP	22291592
MIRT495703	hsa-miR-5010-5p	PAR-CLIP	22291592
MIRT495702	hsa-miR-4447	PAR-CLIP	22291592
MIRT495701	hsa-miR-4472	PAR-CLIP	22291592
MIRT495700	hsa-miR-1275	PAR-CLIP	22291592
MIRT495699	hsa-miR-4665-5p	PAR-CLIP	22291592
MIRT1210171	hsa-miR-1193	CLIP-seq
MIRT1210172	hsa-miR-1287	CLIP-seq
MIRT1210173	hsa-miR-3121-3p	CLIP-seq
MIRT1210174	hsa-miR-3135b	CLIP-seq
MIRT1210175	hsa-miR-3137	CLIP-seq
MIRT1210176	hsa-miR-3153	CLIP-seq
MIRT1210177	hsa-miR-3179	CLIP-seq
MIRT1210178	hsa-miR-34a	CLIP-seq
MIRT1210179	hsa-miR-34c-5p	CLIP-seq
MIRT1210180	hsa-miR-3686	CLIP-seq
MIRT1210181	hsa-miR-3940-5p	CLIP-seq
MIRT1210182	hsa-miR-4327	CLIP-seq
MIRT1210183	hsa-miR-449a	CLIP-seq
MIRT1210184	hsa-miR-449b	CLIP-seq
MIRT1210185	hsa-miR-4507	CLIP-seq
MIRT1210186	hsa-miR-4663	CLIP-seq
MIRT1210187	hsa-miR-4757-5p	CLIP-seq
MIRT1210188	hsa-miR-518a-5p	CLIP-seq
MIRT1210189	hsa-miR-527	CLIP-seq
MIRT1210190	hsa-miR-583	CLIP-seq
MIRT1210191	hsa-miR-625	CLIP-seq
MIRT1210192	hsa-miR-628-5p	CLIP-seq
MIRT2060258	hsa-miR-1294	CLIP-seq
MIRT2060259	hsa-miR-2355-3p	CLIP-seq
MIRT2060260	hsa-miR-4646-3p	CLIP-seq
MIRT2288657	hsa-miR-1254	CLIP-seq
MIRT2288658	hsa-miR-1265	CLIP-seq
MIRT2288659	hsa-miR-3116	CLIP-seq
MIRT2288660	hsa-miR-3127-3p	CLIP-seq
MIRT2288661	hsa-miR-548q	CLIP-seq
MIRT2288662	hsa-miR-550a	CLIP-seq
MIRT2288663	hsa-miR-661	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
MZF1	Activation	17851584
SP1	Activation	17851584
SP3	Activation	17851584

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004668	Function	Protein-arginine deiminase activity	IBA
GO:0004668	Function	Protein-arginine deiminase activity	IDA	27393304
GO:0004668	Function	Protein-arginine deiminase activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	27393304
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12416996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607934	18367	ENSG00000142623

Q9ULC6

Protein name

Protein-arginine deiminase type-1 (EC 3.5.3.15) (Peptidylarginine deiminase I) (Protein-arginine deiminase type I)

Protein function

Catalyzes the deimination of arginine residues of proteins.

PDB

5HP5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08526	PAD_N	1 → 113	Protein-arginine deiminase (PAD) N-terminal domain	Domain
PF08527	PAD_M	115 → 273	Protein-arginine deiminase (PAD) middle domain	Domain
PF03068	PAD	281 → 660	Protein-arginine deiminase (PAD)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in epidermal keratinocytes (at protein level). Epidermis, prostate, testis, placenta, spleen and thymus. {ECO:0000269|PubMed:12416996}.

Sequence

MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVK
EPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLE
VDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDM
SPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVER
QPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP

Sequence length

663

Interactions

View interactions

	Reactome
			Chromatin modifying enzymes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27786579, 29409023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	12877395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28394850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28394850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25389050, 31722418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34352263	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25389050, 31722418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28141715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28068465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22393307, 29316394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22393307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29540791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	28463717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28394850, 29781651, 31731059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	1692206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	1692206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23638076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23638076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28337259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	25593336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31722418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28656745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33741961	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21649721, 31270975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32629995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22393307, 29316394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28613814, 29262583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28394850, 29781651, 31731059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31787362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	31322713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28160557, 28844713, 28850778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31343165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30344729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	30913006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	19760141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28457318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28457318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28463717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18669583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28844713		★★★★★ ★☆☆☆☆ Found in Text Mining only

PADI1 (peptidyl arginine deiminase 1)