Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29941
Gene name	Protein kinase N3
Gene symbol	PKN3
Synonyms (NCBI Gene)	UTDP4-1
Chromosome	9
Chromosome location	9q34.11

Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016540	hsa-miR-193b-3p	Microarray	20304954
MIRT042972	hsa-miR-324-3p	CLASH	23622248
MIRT039934	hsa-miR-615-3p	CLASH	23622248
MIRT036498	hsa-miR-1226-3p	CLASH	23622248
MIRT1237848	hsa-miR-1207-5p	CLIP-seq
MIRT1237849	hsa-miR-1275	CLIP-seq
MIRT1237850	hsa-miR-132	CLIP-seq
MIRT1237851	hsa-miR-142-5p	CLIP-seq
MIRT1237852	hsa-miR-212	CLIP-seq
MIRT1237853	hsa-miR-2467-3p	CLIP-seq
MIRT1237854	hsa-miR-2467-5p	CLIP-seq
MIRT1237855	hsa-miR-3151	CLIP-seq
MIRT1237856	hsa-miR-3179	CLIP-seq
MIRT1237857	hsa-miR-3202	CLIP-seq
MIRT1237858	hsa-miR-340	CLIP-seq
MIRT1237859	hsa-miR-4271	CLIP-seq
MIRT1237860	hsa-miR-4422	CLIP-seq
MIRT1237861	hsa-miR-4447	CLIP-seq
MIRT1237862	hsa-miR-4468	CLIP-seq
MIRT1237863	hsa-miR-4472	CLIP-seq
MIRT1237864	hsa-miR-4475	CLIP-seq
MIRT1237865	hsa-miR-4514	CLIP-seq
MIRT1237866	hsa-miR-4525	CLIP-seq
MIRT1237867	hsa-miR-4645-5p	CLIP-seq
MIRT1237868	hsa-miR-4665-5p	CLIP-seq
MIRT1237869	hsa-miR-4673	CLIP-seq
MIRT1237870	hsa-miR-4692	CLIP-seq
MIRT1237871	hsa-miR-4723-5p	CLIP-seq
MIRT1237872	hsa-miR-4725-3p	CLIP-seq
MIRT1237873	hsa-miR-4747-5p	CLIP-seq
MIRT1237874	hsa-miR-4763-3p	CLIP-seq
MIRT1237875	hsa-miR-491-5p	CLIP-seq
MIRT1237876	hsa-miR-603	CLIP-seq
MIRT1237877	hsa-miR-622	CLIP-seq
MIRT1237878	hsa-miR-625	CLIP-seq
MIRT1237879	hsa-miR-889	CLIP-seq
MIRT1237880	hsa-miR-940	CLIP-seq
MIRT1237849	hsa-miR-1275	CLIP-seq
MIRT2069943	hsa-miR-1285	CLIP-seq
MIRT1237850	hsa-miR-132	CLIP-seq
MIRT1237852	hsa-miR-212	CLIP-seq
MIRT2069944	hsa-miR-3117-5p	CLIP-seq
MIRT1237855	hsa-miR-3151	CLIP-seq
MIRT1237856	hsa-miR-3179	CLIP-seq
MIRT2069945	hsa-miR-3187-5p	CLIP-seq
MIRT1237857	hsa-miR-3202	CLIP-seq
MIRT2069946	hsa-miR-378g	CLIP-seq
MIRT2069947	hsa-miR-4257	CLIP-seq
MIRT1237859	hsa-miR-4271	CLIP-seq
MIRT1237861	hsa-miR-4447	CLIP-seq
MIRT1237863	hsa-miR-4472	CLIP-seq
MIRT2069948	hsa-miR-4486	CLIP-seq
MIRT1237866	hsa-miR-4525	CLIP-seq
MIRT2069949	hsa-miR-4640-5p	CLIP-seq
MIRT1237868	hsa-miR-4665-5p	CLIP-seq
MIRT1237871	hsa-miR-4723-5p	CLIP-seq
MIRT1237872	hsa-miR-4725-3p	CLIP-seq
MIRT2069950	hsa-miR-4726-5p	CLIP-seq
MIRT1237873	hsa-miR-4747-5p	CLIP-seq
MIRT2069951	hsa-miR-4755-3p	CLIP-seq
MIRT1237875	hsa-miR-491-5p	CLIP-seq
MIRT2069952	hsa-miR-612	CLIP-seq
MIRT1237877	hsa-miR-622	CLIP-seq
MIRT1237878	hsa-miR-625	CLIP-seq
MIRT2069953	hsa-miR-720	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10441506
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11432776, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10441506
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	TAS	10441506
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	TAS	10441506
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10441506
GO:0010631	Process	Epithelial cell migration	IDA	21754995
GO:0010631	Process	Epithelial cell migration	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
610714	17999	ENSG00000160447

Q6P5Z2

Protein name

Serine/threonine-protein kinase N3 (EC 2.7.11.13) (Protein kinase PKN-beta) (Protein-kinase C-related kinase 3)

Protein function

Contributes to invasiveness in malignant prostate cancer.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02185	HR1	20 → 80	Hr1 repeat	Family
PF02185	HR1	106 → 173	Hr1 repeat	Family
PF02185	HR1	180 → 246	Hr1 repeat	Family
PF00069	Pkinase	559 → 818	Protein kinase domain	Domain
PF00433	Pkinase_C	841 → 881	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in prostate tumors and various cancer cell lines. Not expressed in adult tissues. {ECO:0000269|PubMed:10441506}.

Sequence

MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSS
NRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKV
KQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLA
EELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLL
EQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVI
PLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVI
ERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSTISPPKGCPRT
PTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSEETPRTKRPHMEPRTR
RGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQ
ARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFC
GTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG
FLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLC
GPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP

Sequence length

889

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway		RHO GTPases activate PKNs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32525932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28851822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30422386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32525932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32525932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30422386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19047158, 26742562, 30422386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15282551, 21754995, 29098022, 30024300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28851822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28851822		★★★★★ ★☆☆☆☆ Found in Text Mining only

PKN3 (protein kinase N3)