NME7 (NME/NM23 family member 7)

Gene

• Entrez ID: 29922
• Gene name: NME/NM23 family member 7
• Gene symbol: NME7
• Synonyms (NCBI Gene): CFAP67, MN23H7, NDK 7, NDK7, nm23-H7
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: This gene encodes a member of the non-metastatic expressed family of nucleoside diphosphate kinases. Members of this family are enzymes that catalyzes phosphate transfer from nucleoside triphosphates to nucleoside diphosphates. This protein contains two k

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq
MIRT1187685	hsa-miR-151-3p	CLIP-seq
MIRT1187686	hsa-miR-4463	CLIP-seq
MIRT1187687	hsa-miR-4499	CLIP-seq
MIRT1187688	hsa-miR-4694-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000931	Component	Gamma-tubulin ring complex	IDA	24807905
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	IEA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	16313181, 24807905
GO:0004672	Function	Protein kinase activity	IDA	34764205
GO:0004672	Function	Protein kinase activity	IMP	24807905
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 21988832, 25416956, 26638075, 27107012, 27173435, 29892012, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	24807905
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24807905
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614, 24807905, 38538594, 39824631
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IBA
GO:0005879	Component	Axonemal microtubule	IDA	36191189, 37258679
GO:0005879	Component	Axonemal microtubule	IEA
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IDA	38538594, 39824631
GO:0005929	Component	Cilium	IEA
GO:0006183	Process	GTP biosynthetic process	IEA
GO:0006228	Process	UTP biosynthetic process	IEA
GO:0006241	Process	CTP biosynthetic process	IEA
GO:0006308	Process	DNA catabolic process	IDA	16313181
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007420	Process	Brain development	IEA
GO:0008296	Function	3'-5'-DNA exonuclease activity	IDA	16313181
GO:0010968	Process	Regulation of microtubule nucleation	IMP	24807905
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IDA	39824631
GO:0036064	Component	Ciliary basal body	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042073	Process	Intraciliary transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043113	Process	Receptor clustering	IEA
GO:0060271	Process	Cilium assembly	IDA	39824631
GO:0060972	Process	Left/right pattern formation	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 613465
• HGNC: 20461
• e!Ensembl: ENSG00000143156

Protein

• UniProt ID: Q9Y5B8
• Protein name: Nucleoside diphosphate kinase homolog 7 (NDK 7) (NDP kinase homolog 7) (3'-5' exonuclease NME7) (EC 3.1.-.-) (Protein kinase NME7) (EC 2.7.-.-) (nm23-H7)
• Protein function: Possesses an intrinsic kinase activity (PubMed:24807905). Displays 3'-5' exonuclease activity with a preference for single-stranded DNA (PubMed:16313181). Does not seem to have nucleoside diphosphate kinase activity (PubMed:16313181, PubMed:2480
• PDB: 7UNG, 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00334	NDK	92 → 226	Nucleoside diphosphate kinase	Domain
  PF00334	NDK	238 → 375	Nucleoside diphosphate kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.
• Sequence:

  MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDL
  FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTI
  TKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPAN
  SGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCT
  CCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT
  EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
  EDGLLEVQYFFKILDN

• Sequence length: 376

Pathways

KEGG:

Purine metabolism
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism
Biosynthesis of cofactors

Reactome:

Recruitment of mitotic centrosome proteins and complexes
Recruitment of NuMA to mitotic centrosomes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLOOD COAGULATION DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NME7-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SITUS INVERSUS	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SITUS INVERSUS TOTALIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	25311278	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39217320	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15726650		★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	27060491		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	30484681		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30484681		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrocephalus	Hydrocephalus	Pubtator	27060491	Associate	★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	BEFREE	21562815		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15726650		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30484681		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	40240887	Associate	★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	21562815		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	ORPHANET_DG	27060491		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Situs Inversus	Situs inversus	Pubtator	27060491	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Situs inversus totalis	Situs Inversus	BEFREE	27060491		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Venous thromboembolism	Pubtator	22672568, 28301549	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations