Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29899
Gene name	G protein signaling modulator 2
Gene symbol	GPSM2
Synonyms (NCBI Gene)	CMCSDFNB82LGNPINS
Chromosome	1
Chromosome location	1p13.3
Summary	The protein encoded by this gene belongs to a family of proteins that modulate activation of G proteins, which transduce extracellular signals received by cell surface receptors into integrated cellular responses. The N-terminal half of this protein conta

Show/Hide all (19)

SNP ID	Visualize variation	Clinical significance	Consequence
rs79730689	C>T	Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, genic downstream transcript variant
rs145191476	C>A	Pathogenic	Coding sequence variant, genic downstream transcript variant, stop gained
rs184863735	A>G	Conflicting-interpretations-of-pathogenicity	Intron variant
rs267606854	C>T	Pathogenic	Coding sequence variant, stop gained
rs367682612	C>T	Pathogenic	Coding sequence variant, stop gained
rs370907055	C>T	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs387907010	C>T	Pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs528069912	C>-	Pathogenic, likely-pathogenic	Coding sequence variant, frameshift variant
rs727505300	TG>-	Pathogenic	Coding sequence variant, frameshift variant
rs750981446	AAGT>-	Pathogenic	Coding sequence variant, splice donor variant, genic downstream transcript variant, intron variant
rs755804651	C>A	Pathogenic	Coding sequence variant, missense variant
rs766556930	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs772372530	G>-	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant
rs773068151	G>T	Pathogenic	Splice acceptor variant
rs777695770	G>T	Pathogenic	Splice donor variant
rs1060499797	G>A	Pathogenic	Stop gained, coding sequence variant
rs1553215684	C>T	Likely-pathogenic	Genic downstream transcript variant, downstream transcript variant, coding sequence variant, stop gained
rs1553216524	TGCCATAC>-	Likely-pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1570936325	->TGTAC	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002524	hsa-miR-373-3p	Microarray	15685193
MIRT002524	hsa-miR-373-3p	Microarray;Other	15685193
MIRT024301	hsa-miR-215-5p	Microarray	19074876
MIRT026240	hsa-miR-192-5p	Microarray	19074876
MIRT709231	hsa-miR-3660	HITS-CLIP	19536157
MIRT709230	hsa-miR-4526	HITS-CLIP	19536157
MIRT709229	hsa-miR-17-3p	HITS-CLIP	19536157
MIRT709228	hsa-miR-378a-5p	HITS-CLIP	19536157
MIRT709227	hsa-miR-569	HITS-CLIP	19536157
MIRT709226	hsa-miR-323a-3p	HITS-CLIP	19536157
MIRT709225	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT709224	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT709223	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT709222	hsa-miR-4474-5p	HITS-CLIP	19536157
MIRT609894	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT609893	hsa-miR-5687	HITS-CLIP	23824327
MIRT709231	hsa-miR-3660	HITS-CLIP	19536157
MIRT709230	hsa-miR-4526	HITS-CLIP	19536157
MIRT709229	hsa-miR-17-3p	HITS-CLIP	19536157
MIRT709228	hsa-miR-378a-5p	HITS-CLIP	19536157
MIRT709227	hsa-miR-569	HITS-CLIP	19536157
MIRT709226	hsa-miR-323a-3p	HITS-CLIP	19536157
MIRT709225	hsa-miR-3065-3p	HITS-CLIP	19536157
MIRT709224	hsa-miR-383-3p	HITS-CLIP	19536157
MIRT709223	hsa-miR-4704-3p	HITS-CLIP	19536157
MIRT709222	hsa-miR-4474-5p	HITS-CLIP	19536157
MIRT609894	hsa-miR-32-3p	HITS-CLIP	23824327
MIRT609893	hsa-miR-5687	HITS-CLIP	23824327
MIRT1032405	hsa-miR-1260	CLIP-seq
MIRT1032406	hsa-miR-1260b	CLIP-seq
MIRT1032407	hsa-miR-188-3p	CLIP-seq
MIRT1032408	hsa-miR-3156-3p	CLIP-seq
MIRT1032409	hsa-miR-4301	CLIP-seq
MIRT2238696	hsa-miR-155	CLIP-seq
MIRT2238697	hsa-miR-216a	CLIP-seq
MIRT2238698	hsa-miR-216b	CLIP-seq
MIRT2238699	hsa-miR-22	CLIP-seq
MIRT2238700	hsa-miR-3133	CLIP-seq
MIRT2238701	hsa-miR-342-3p	CLIP-seq
MIRT2238702	hsa-miR-34b	CLIP-seq
MIRT2238703	hsa-miR-365	CLIP-seq
MIRT2238704	hsa-miR-4457	CLIP-seq
MIRT2238705	hsa-miR-4724-5p	CLIP-seq
MIRT2238706	hsa-miR-4733-5p	CLIP-seq
MIRT2238707	hsa-miR-493	CLIP-seq
MIRT2238708	hsa-miR-513b	CLIP-seq
MIRT2238709	hsa-miR-532-5p	CLIP-seq
MIRT2238710	hsa-miR-633	CLIP-seq
MIRT2465402	hsa-miR-198	CLIP-seq
MIRT2465403	hsa-miR-3919	CLIP-seq
MIRT2465404	hsa-miR-3939	CLIP-seq
MIRT2465405	hsa-miR-520a-5p	CLIP-seq
MIRT2465406	hsa-miR-523	CLIP-seq
MIRT2465407	hsa-miR-525-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IBA
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	22327364, 23870127
GO:0000166	Function	Nucleotide binding	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IBA
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0005092	Function	GDP-dissociation inhibitor activity	IBA
GO:0005092	Function	GDP-dissociation inhibitor activity	IEA
GO:0005092	Function	GDP-dissociation inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	11781568, 12445386, 15537540, 15632202, 16458856, 21816348, 22074847, 22327364, 26766442, 27462074, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	11781568
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IBA
GO:0005938	Component	Cell cortex	IDA	21816348, 23027904, 23783028, 23870127
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	IMP	22074847
GO:0007052	Process	Mitotic spindle organization	IMP	21816348
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8973305
GO:0009642	Process	Response to light intensity	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019904	Function	Protein domain specific binding	IPI	22074847
GO:0030695	Function	GTPase regulator activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	16458856
GO:0032991	Component	Protein-containing complex	IMP	22074847
GO:0042802	Function	Identical protein binding	IPI	15537540
GO:0051301	Process	Cell division	IEA
GO:0051661	Process	Maintenance of centrosome location	IMP	21816348
GO:0060236	Process	Regulation of mitotic spindle organization	IMP	23027904
GO:0070840	Function	Dynein complex binding	IDA	22327364
GO:0097431	Component	Mitotic spindle pole	IDA	21816348
GO:0097431	Component	Mitotic spindle pole	IDA	11781568
GO:0097575	Component	Lateral cell cortex	IDA	26766442
GO:0097575	Component	Lateral cell cortex	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0099738	Component	Cell cortex region	IDA	22327364
GO:1904778	Process	Positive regulation of protein localization to cell cortex	IMP	22327364, 23027904, 23870127
GO:1905832	Process	Positive regulation of spindle assembly	IMP	11781568

MIM	HGNC	e!Ensembl
609245	29501	ENSG00000121957

P81274

Protein name

G-protein-signaling modulator 2 (Mosaic protein LGN)

Protein function

Plays an important role in mitotic spindle pole organization via its interaction with NUMA1 (PubMed:11781568, PubMed:15632202, PubMed:21816348). Required for cortical dynein-dynactin complex recruitment during metaphase (PubMed:22327364). Plays

PDB

3SF4 , 4WND , 4WNE , 4WNF , 4WNG , 5A6C , 6HC2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13176	TPR_7	64 → 99	Tetratricopeptide repeat	Repeat
PF13176	TPR_7	204 → 239	Tetratricopeptide repeat	Repeat
PF13181	TPR_8	322 → 355	Tetratricopeptide repeat	Repeat
PF02188	GoLoco	490 → 511	GoLoco motif	Motif
PF02188	GoLoco	545 → 566	GoLoco motif	Motif
PF02188	GoLoco	595 → 616	GoLoco motif	Motif
PF02188	GoLoco	629 → 650	GoLoco motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed.

Sequence

MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKT
LSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDE
AIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQA
AVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAA
ERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEK
AIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSG
ELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPE
KVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQR
KISADTIGDEGFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVV
SPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDI
LVKCQGSRLDDQRCAPPPATTKGPTVPDEDFFSLILRSQGKRMDEQRVLLQRDQNRDTDF
GLKDFLQNNALLEFKNSGKKSADH

Sequence length

684

Interactions

View interactions

	Reactome
			G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Breast-ovarian cancer, familial, susceptibility to, 2	Pathogenic	rs267606854	RCV004813028	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chudley-McCullough syndrome	Likely pathogenic; Pathogenic	rs2101429459, rs762285081, rs773445398, rs2101542489, rs2101528079, rs267606854, rs772372530, rs774168389, rs957559316, rs1060499797, rs387907010, rs528069912, rs145191476, rs777695770, rs370907055, rs1553216524, rs761092578 View all (2 more)	RCV001374666 RCV001728014 RCV001782230 RCV001782231 RCV001807949 View all (12 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Deafness	Likely pathogenic; Pathogenic	rs755804651	RCV000679817	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GPSM2-related disorder	Pathogenic; Likely pathogenic	rs772372530, rs2524888761, rs528069912, rs370907055	RCV004529480 RCV003899768 RCV004528135 RCV004527679	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing loss, autosomal recessive	Pathogenic; Likely pathogenic	rs267606854, rs1060499797, rs755804651	RCV000454206 RCV000454299 RCV001291335	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rare genetic deafness	Likely pathogenic; Pathogenic	rs727505300, rs773068151, rs772372530, rs528069912, rs370907055	RCV000156837 RCV000218080 RCV000607932 RCV000844707 RCV000604753	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE ISOLATED SENSORINEURAL DEAFNESS TYPE DFNB	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	-; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	8560986		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	8560986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cyst	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic sensorineural deafness type DFNB	Non-Syndromic Sensorineural Deafness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20589935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28347229	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32812493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26043775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	GENOMICS_ENGLAND_DG	20602914, 22578326, 8973305		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	CLINGEN_DG	20602914, 21348867, 22578326, 23494849, 26662512, 27180139, 28387217		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	BEFREE	22578326, 23494849, 27064331, 27180139, 28387217, 29799026		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	CTD_human_DG	22578326		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	ORPHANET_DG	22578326		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-McCullough syndrome	Chudley-Mccullough Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital anomaly of brain	Brain malformation	BEFREE	22578326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	BEFREE	27180139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26043775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	21348867	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29719397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgenesis of corpus callosum	Dysplastic corpus callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	29153326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	19888295	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	22578326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	22578326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28347229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26915683, 28347229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35940821	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20589935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21897333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26915683, 28347229		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28387217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal heterotopia	Neuronal Heterotopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	22578326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	20602914, 22578326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial agenesis of corpus callosum	Partial Agenesis Of Corpus Callosum	BEFREE	27064331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial agenesis of corpus callosum	Partial Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36601001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	19296131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26043775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	22578326, 27064331, 28387217		★★★★★ ★☆☆☆☆ Found in Text Mining only

GPSM2 (G protein signaling modulator 2)