Gene Gene information from NCBI Gene database.
Entrez ID 29895
Gene name Myosin light chain 11
Gene symbol MYL11
Synonyms (NCBI Gene)
DA1CHUMMLC2BMLC2BMRLC2MYLPF
Chromosome 16
Chromosome location 16p11.2
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT018812 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm IBA
GO:0005765 Component Lysosomal membrane HDA 17897319
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617378 29824 ENSG00000180209
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96A32
Protein name Myosin regulatory light chain 11 (Fast skeletal myosin light chain 2) (MLC2B) (Myosin light chain 11) (Myosin regulatory light chain 2, skeletal muscle isoform)
Protein function Myosin regulatory subunit that plays an essential role to maintain muscle integrity during early development (By similarity). Plays a role in muscle contraction (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13405 EF-hand_6 29 58 EF-hand domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal and adult skeletal muscle. {ECO:0000269|PubMed:14756420}.
Sequence
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Sequence length 169
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Focal adhesion
Adherens junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Motor proteins
Cytoskeleton in muscle cells
Shigellosis
Salmonella infection
  Smooth Muscle Contraction
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Arthrogryposis, distal, type 1C Likely pathogenic; Pathogenic rs2049733161, rs748809300, rs756765686, rs2049768364 RCV001268957
RCV002221613
RCV002221612
RCV001268956
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Distal arthrogryposis Likely pathogenic; Pathogenic rs2049733161, rs748809300, rs756765686, rs2049768364 RCV001172491
RCV001172489
RCV001172488
RCV001172490
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DISTAL ARTHROGRYPOSIS SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autistic Disorder Autism BEFREE 29661901
★☆☆☆☆
Found in Text Mining only
Conduction disorder of the heart Conduction Disorder Of The Heart BEFREE 29451818
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 22469987
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 29661901
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 27901489
★☆☆☆☆
Found in Text Mining only
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS Megalencephalic Leukoencephalopathy With Subcortical Cysts BEFREE 29661901
★☆☆☆☆
Found in Text Mining only
Turner Syndrome Turner syndrome Pubtator 32210915 Associate
★☆☆☆☆
Found in Text Mining only