Gene Gene information from NCBI Gene database.
Entrez ID 29887
Gene name Sorting nexin 10
Gene symbol SNX10
Synonyms (NCBI Gene)
OPTB8
Chromosome 7
Chromosome location 7p15.2
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
SNPs SNP information provided by dbSNP.
5
SNP ID Visualize variation Clinical significance Consequence
rs377321694 T>A,C Pathogenic Synonymous variant, coding sequence variant, intron variant, stop gained
rs398123011 G>A Pathogenic Missense variant, coding sequence variant, intron variant
rs587777490 C>T Pathogenic Coding sequence variant, genic upstream transcript variant, stop gained
rs897553060 G>A Likely-pathogenic Missense variant, coding sequence variant
rs1353879401 C>T Likely-pathogenic Coding sequence variant, intron variant, stop gained
miRNA miRNA information provided by mirtarbase database.
135
miRTarBase ID miRNA Experiments Reference
MIRT024587 hsa-miR-215-5p Microarray 19074876
MIRT026783 hsa-miR-192-5p Microarray 19074876
MIRT543820 hsa-miR-6507-5p PAR-CLIP 21572407
MIRT103410 hsa-miR-126-5p PAR-CLIP 21572407
MIRT543819 hsa-miR-3928-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
44
GO ID Ontology Definition Evidence Reference
GO:0001696 Process Gastric acid secretion IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005545 Function 1-phosphatidylinositol binding IMP 17012226
GO:0005634 Component Nucleus IDA 22174188
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614780 14974 ENSG00000086300
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5X0
Protein name Sorting nexin-10
Protein function Probable phosphoinositide-binding protein involved in protein sorting and membrane trafficking in endosomes. Plays a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium. Required for the l
PDB 4ON3 , 4PZG , 6KOK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 40 124 PX domain Domain
Sequence
MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWL
RQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLF
LQSH
LNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGL
GHSSDDSSSHGCKVNTAPQES
Sequence length 201
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive osteopetrosis 8 Pathogenic; Likely pathogenic rs587777490, rs2536153865, rs398123011, rs1353879401 RCV000128452
RCV003444394
RCV000033149
RCV000991381
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer Likely pathogenic rs776348160 RCV005922844
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE OSTEOPETROSIS Disgenet
Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 29452206
★☆☆☆☆
Found in Text Mining only
Anemia Anemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 33594863 Associate
★☆☆☆☆
Found in Text Mining only
Autosomal recessive malignant osteopetrosis Malignant Osteopetrosis Orphanet
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone Disease BEFREE 22174188
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 34116656 Associate
★☆☆☆☆
Found in Text Mining only
Chronic rhinitis Rhinitis HPO_DG
★☆☆☆☆
Found in Text Mining only
Colitis Colitis BEFREE 26856241
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 29355659, 29867114, 31208298
★☆☆☆☆
Found in Text Mining only
Cranial nerve palsies Cranial Nerve Paralysis HPO_DG
★☆☆☆☆
Found in Text Mining only