Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29775
Gene name	Caspase recruitment domain family member 10
Gene symbol	CARD10
Synonyms (NCBI Gene)	BIMP1CARMA3IMD89
Chromosome	22
Chromosome location	22q13.1
Summary	The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs139006752	G>A	Risk-factor	Coding sequence variant, missense variant
rs200148764	C>T	Risk-factor	Coding sequence variant, missense variant
rs201794655	G>A	Risk-factor	Coding sequence variant, missense variant
rs750643216	G>A	Risk-factor	Coding sequence variant, missense variant
rs1057519378	C>A,T	Risk-factor	Coding sequence variant, missense variant

132

Show/Hide all (132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020696	hsa-miR-155-5p	Other	20584899
MIRT027101	hsa-miR-103a-3p	Sequencing	20371350
MIRT030440	hsa-miR-24-3p	Microarray	19748357
MIRT031650	hsa-miR-16-5p	Sequencing	20371350
MIRT053495	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT053495	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT053495	hsa-miR-146a-5p	Luciferase reporter assayQRTPCRWestern blot	24985472
MIRT479989	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479988	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT479987	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT479986	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT479985	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT031650	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT479984	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT479983	hsa-miR-3664-5p	PAR-CLIP	23592263
MIRT479982	hsa-miR-2278	PAR-CLIP	23592263
MIRT479981	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT479980	hsa-miR-5697	PAR-CLIP	23592263
MIRT479979	hsa-miR-6501-3p	PAR-CLIP	23592263
MIRT479978	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479977	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT479976	hsa-miR-4532	PAR-CLIP	23592263
MIRT479975	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT479974	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT479973	hsa-miR-4481	PAR-CLIP	23592263
MIRT479972	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT479971	hsa-miR-3175	PAR-CLIP	23592263
MIRT479970	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT479969	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT479968	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT479967	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT479966	hsa-miR-4449	PAR-CLIP	23592263
MIRT479965	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT479964	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT479963	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT030440	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	26252200
MIRT030440	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	26252200
MIRT479989	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT479988	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT479987	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT479986	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT479985	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT031650	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT479984	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT479983	hsa-miR-3664-5p	PAR-CLIP	23592263
MIRT479982	hsa-miR-2278	PAR-CLIP	23592263
MIRT479981	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT479980	hsa-miR-5697	PAR-CLIP	23592263
MIRT479979	hsa-miR-6501-3p	PAR-CLIP	23592263
MIRT479978	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479977	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT479976	hsa-miR-4532	PAR-CLIP	23592263
MIRT479975	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT479974	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT479973	hsa-miR-4481	PAR-CLIP	23592263
MIRT479972	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT479971	hsa-miR-3175	PAR-CLIP	23592263
MIRT479970	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT479969	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT479968	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT479967	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT479966	hsa-miR-4449	PAR-CLIP	23592263
MIRT479965	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT479964	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT479963	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT862760	hsa-miR-1207-5p	CLIP-seq
MIRT862761	hsa-miR-1275	CLIP-seq
MIRT862762	hsa-miR-1301	CLIP-seq
MIRT862763	hsa-miR-155	CLIP-seq
MIRT862764	hsa-miR-1915	CLIP-seq
MIRT862765	hsa-miR-3189-3p	CLIP-seq
MIRT862766	hsa-miR-3918	CLIP-seq
MIRT862767	hsa-miR-3944-5p	CLIP-seq
MIRT862768	hsa-miR-425	CLIP-seq
MIRT862769	hsa-miR-4263	CLIP-seq
MIRT862770	hsa-miR-4436b-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT862771	hsa-miR-4640-5p	CLIP-seq
MIRT862772	hsa-miR-4660	CLIP-seq
MIRT862773	hsa-miR-4665-5p	CLIP-seq
MIRT862774	hsa-miR-4685-5p	CLIP-seq
MIRT862775	hsa-miR-4726-5p	CLIP-seq
MIRT862776	hsa-miR-4763-3p	CLIP-seq
MIRT862777	hsa-miR-5047	CLIP-seq
MIRT862778	hsa-miR-548t	CLIP-seq
MIRT862779	hsa-miR-885-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT862760	hsa-miR-1207-5p	CLIP-seq
MIRT2193468	hsa-miR-125a-3p	CLIP-seq
MIRT2193469	hsa-miR-146a	CLIP-seq
MIRT2193470	hsa-miR-146b-5p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT862771	hsa-miR-4640-5p	CLIP-seq
MIRT2193471	hsa-miR-4649-5p	CLIP-seq
MIRT862774	hsa-miR-4685-5p	CLIP-seq
MIRT862775	hsa-miR-4726-5p	CLIP-seq
MIRT862776	hsa-miR-4763-3p	CLIP-seq
MIRT2193472	hsa-miR-4773	CLIP-seq
MIRT2193473	hsa-miR-508-5p	CLIP-seq
MIRT2193474	hsa-miR-552	CLIP-seq
MIRT2193475	hsa-miR-589	CLIP-seq
MIRT2193476	hsa-miR-591	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT2446155	hsa-miR-1	CLIP-seq
MIRT2446156	hsa-miR-206	CLIP-seq
MIRT2446157	hsa-miR-4301	CLIP-seq
MIRT2446158	hsa-miR-4491	CLIP-seq
MIRT2446159	hsa-miR-4657	CLIP-seq
MIRT2446160	hsa-miR-4727-3p	CLIP-seq
MIRT2446161	hsa-miR-613	CLIP-seq
MIRT2496631	hsa-miR-1294	CLIP-seq
MIRT862764	hsa-miR-1915	CLIP-seq
MIRT2496632	hsa-miR-3150b-3p	CLIP-seq
MIRT2496633	hsa-miR-3184	CLIP-seq
MIRT2496634	hsa-miR-3607-5p	CLIP-seq
MIRT2496635	hsa-miR-423-5p	CLIP-seq
MIRT2496636	hsa-miR-4316	CLIP-seq
MIRT862770	hsa-miR-4436b-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT862774	hsa-miR-4685-5p	CLIP-seq
MIRT2496637	hsa-miR-4689	CLIP-seq
MIRT2496638	hsa-miR-4784	CLIP-seq
MIRT862779	hsa-miR-885-3p	CLIP-seq
MIRT862764	hsa-miR-1915	CLIP-seq
MIRT862770	hsa-miR-4436b-3p	CLIP-seq
MIRT738165	hsa-miR-455-3p	CLIP-seq
MIRT862774	hsa-miR-4685-5p	CLIP-seq
MIRT862779	hsa-miR-885-3p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IBA
GO:0005515	Function	Protein binding	IPI	11259443, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	11259443
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	IDA	11259443
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	NAS	11259443
GO:0032449	Component	CBM complex	NAS	15125833
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0050776	Process	Regulation of immune response	IBA
GO:0065003	Process	Protein-containing complex assembly	NAS	11259443
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IMP	24863965
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	24863965

MIM	HGNC	e!Ensembl
607209	16422	ENSG00000100065

Q9BWT7

Protein name

Caspase recruitment domain-containing protein 10 (CARD-containing MAGUK protein 3) (Carma 3)

Protein function

Scaffold protein that plays an important role in mediating the activation of NF-kappa-B via BCL10 or EGFR.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00619	CARD	28 → 114	Caspase recruitment domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in adult heart, kidney and liver; lower levels in intestine, placenta, muscle and lung. Also found in fetal lung, liver and kidney.

Sequence

MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLARALNPAKLTPYLRQCRVIDEQ
DEEEVLSTYRFPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQ
AQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLK
VSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLVSELRAENQRLTASLRELQEG
LQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQEM
EDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYR
KQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLS
EFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDP
APPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAI
RVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAAGLEGA
CLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPERAD
PHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNYQRAQQLLEVQEKCL
PSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPL
LVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPA
TPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGR
PGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVEC
GSSRGCPSSSEA

Sequence length

1032

Interactions

View interactions

	KEGG
	NF-kappa B signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 89 and autoimmunity	Pathogenic	rs748488870	RCV001787025	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE HEPATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARD10-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	risk factor; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	risk factor; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	risk factor; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary open angle glaucoma	risk factor	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	risk factor; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	32138469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18757306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	24768677		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26277595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30723269, 31496734, 31565867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23708960, 29259013, 31409895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23708960	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31409895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23771851, 24018495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31576094	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24018495	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31576094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30723269, 31496734, 31565867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22615840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24833094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23771851, 31939627, 34190011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22884800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24787958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23771851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30008619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24018495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	29049738, 38241218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25798827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22761751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	CLINVAR_DG	27896285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23893382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23893382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31576094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22615840, 26526492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23708960, 29259013, 31409895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22615840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22992343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30723269, 31496734, 31565867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21406399, 23771851, 26526492, 30158935, 31565867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22884800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20695076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21406399, 22615840, 22992343, 23708960, 23771851, 23893382, 31496734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22615840		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17724468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17724468, 24833094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24633921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28301668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23771851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20695076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22992343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24443255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CARD10 (caspase recruitment domain family member 10)