Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2965
Gene name	General transcription factor IIH subunit 1
Gene symbol	GTF2H1
Synonyms (NCBI Gene)	BTF2P62TFB1TFIIH
Chromosome	11
Chromosome location	11p15.1

451

Show/Hide all (451)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000851	hsa-miR-15a-5p	Microarray	18362358
MIRT000850	hsa-miR-16-5p	Microarray	18362358
MIRT021862	hsa-miR-132-3p	Microarray	17612493
MIRT024028	hsa-miR-1-3p	Proteomics	18668040
MIRT028676	hsa-miR-30a-5p	Proteomics	18668040
MIRT048641	hsa-miR-99a-5p	CLASH	23622248
MIRT048496	hsa-miR-100-5p	CLASH	23622248
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT542357	hsa-miR-4643	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523364	hsa-miR-891b	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT523363	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542356	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT542357	hsa-miR-4643	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT542355	hsa-miR-466	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509988	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523364	hsa-miR-891b	PAR-CLIP	23446348
MIRT509987	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523363	hsa-miR-450b-5p	PAR-CLIP	23446348
MIRT509982	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509988	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509987	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509984	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509982	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT611873	hsa-miR-7703	HITS-CLIP	23824327
MIRT611872	hsa-miR-4325	HITS-CLIP	23824327
MIRT523363	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT611871	hsa-miR-507	HITS-CLIP	23824327
MIRT611870	hsa-miR-557	HITS-CLIP	23824327
MIRT611869	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT611868	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT542357	hsa-miR-4643	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT523364	hsa-miR-891b	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT523363	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT542356	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT542357	hsa-miR-4643	PAR-CLIP	21572407
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509988	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509987	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT542355	hsa-miR-466	PAR-CLIP	21572407
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509984	hsa-miR-493-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509982	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509988	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT523364	hsa-miR-891b	PAR-CLIP	23446348
MIRT509987	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523363	hsa-miR-450b-5p	PAR-CLIP	23446348
MIRT509982	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT509990	hsa-miR-5580-3p	PAR-CLIP	23446348
MIRT509989	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509988	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509987	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509985	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT509986	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509984	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT509983	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509982	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT1036868	hsa-miR-1200	CLIP-seq
MIRT1036869	hsa-miR-1205	CLIP-seq
MIRT1036870	hsa-miR-1248	CLIP-seq
MIRT1036871	hsa-miR-1257	CLIP-seq
MIRT1036872	hsa-miR-1276	CLIP-seq
MIRT1036873	hsa-miR-1305	CLIP-seq
MIRT1036874	hsa-miR-130a	CLIP-seq
MIRT1036875	hsa-miR-130b	CLIP-seq
MIRT1036876	hsa-miR-132	CLIP-seq
MIRT1036877	hsa-miR-148a	CLIP-seq
MIRT1036878	hsa-miR-148b	CLIP-seq
MIRT1036879	hsa-miR-152	CLIP-seq
MIRT1036880	hsa-miR-181a	CLIP-seq
MIRT1036881	hsa-miR-181b	CLIP-seq
MIRT1036882	hsa-miR-181c	CLIP-seq
MIRT1036883	hsa-miR-181d	CLIP-seq
MIRT1036884	hsa-miR-194	CLIP-seq
MIRT1036885	hsa-miR-19a	CLIP-seq
MIRT1036886	hsa-miR-19b	CLIP-seq
MIRT1036887	hsa-miR-212	CLIP-seq
MIRT1036888	hsa-miR-28-3p	CLIP-seq
MIRT1036889	hsa-miR-301a	CLIP-seq
MIRT1036890	hsa-miR-301b	CLIP-seq
MIRT1036891	hsa-miR-30a	CLIP-seq
MIRT1036892	hsa-miR-30b	CLIP-seq
MIRT1036893	hsa-miR-30c	CLIP-seq
MIRT1036894	hsa-miR-30d	CLIP-seq
MIRT1036895	hsa-miR-30e	CLIP-seq
MIRT1036896	hsa-miR-3124-3p	CLIP-seq
MIRT1036897	hsa-miR-3180-5p	CLIP-seq
MIRT1036898	hsa-miR-3192	CLIP-seq
MIRT1036899	hsa-miR-326	CLIP-seq
MIRT1036900	hsa-miR-330-3p	CLIP-seq
MIRT1036901	hsa-miR-330-5p	CLIP-seq
MIRT1036902	hsa-miR-338-5p	CLIP-seq
MIRT1036903	hsa-miR-3647-3p	CLIP-seq
MIRT1036904	hsa-miR-3665	CLIP-seq
MIRT1036905	hsa-miR-3666	CLIP-seq
MIRT1036906	hsa-miR-3671	CLIP-seq
MIRT1036907	hsa-miR-4262	CLIP-seq
MIRT1036908	hsa-miR-4276	CLIP-seq
MIRT1036909	hsa-miR-4295	CLIP-seq
MIRT1036910	hsa-miR-4311	CLIP-seq
MIRT1036911	hsa-miR-4314	CLIP-seq
MIRT1036912	hsa-miR-4324	CLIP-seq
MIRT1036913	hsa-miR-4418	CLIP-seq
MIRT1036914	hsa-miR-4509	CLIP-seq
MIRT1036915	hsa-miR-454	CLIP-seq
MIRT1036916	hsa-miR-4645-3p	CLIP-seq
MIRT1036917	hsa-miR-4646-5p	CLIP-seq
MIRT1036918	hsa-miR-4659a-3p	CLIP-seq
MIRT1036919	hsa-miR-4659b-3p	CLIP-seq
MIRT1036920	hsa-miR-4704-3p	CLIP-seq
MIRT1036921	hsa-miR-4711-5p	CLIP-seq
MIRT1036922	hsa-miR-4744	CLIP-seq
MIRT1036923	hsa-miR-4762-3p	CLIP-seq
MIRT1036924	hsa-miR-4766-5p	CLIP-seq
MIRT1036925	hsa-miR-4778-3p	CLIP-seq
MIRT1036926	hsa-miR-4799-5p	CLIP-seq
MIRT1036927	hsa-miR-509-3-5p	CLIP-seq
MIRT1036928	hsa-miR-509-5p	CLIP-seq
MIRT1036929	hsa-miR-515-5p	CLIP-seq
MIRT1036930	hsa-miR-520a-5p	CLIP-seq
MIRT1036931	hsa-miR-525-5p	CLIP-seq
MIRT1036932	hsa-miR-543	CLIP-seq
MIRT1036933	hsa-miR-544b	CLIP-seq
MIRT1036934	hsa-miR-583	CLIP-seq
MIRT1036935	hsa-miR-607	CLIP-seq
MIRT1036936	hsa-miR-622	CLIP-seq
MIRT1036937	hsa-miR-646	CLIP-seq
MIRT1036938	hsa-miR-657	CLIP-seq
MIRT1036939	hsa-miR-802	CLIP-seq
MIRT1036940	hsa-miR-2117	CLIP-seq
MIRT1036941	hsa-miR-216a	CLIP-seq
MIRT1036942	hsa-miR-3168	CLIP-seq
MIRT1036943	hsa-miR-342-3p	CLIP-seq
MIRT1036944	hsa-miR-4719	CLIP-seq
MIRT1036923	hsa-miR-4762-3p	CLIP-seq
MIRT1036924	hsa-miR-4766-5p	CLIP-seq
MIRT1036945	hsa-miR-4768-5p	CLIP-seq
MIRT1036946	hsa-miR-4775	CLIP-seq
MIRT1036947	hsa-miR-548a-5p	CLIP-seq
MIRT1036948	hsa-miR-548ab	CLIP-seq
MIRT1036949	hsa-miR-548ak	CLIP-seq
MIRT1036950	hsa-miR-548b-5p	CLIP-seq
MIRT1036951	hsa-miR-548c-5p	CLIP-seq
MIRT1036952	hsa-miR-548d-5p	CLIP-seq
MIRT1036953	hsa-miR-548h	CLIP-seq
MIRT1036954	hsa-miR-548i	CLIP-seq
MIRT1036955	hsa-miR-548j	CLIP-seq
MIRT1036956	hsa-miR-548k	CLIP-seq
MIRT1036957	hsa-miR-548l	CLIP-seq
MIRT1036958	hsa-miR-548w	CLIP-seq
MIRT1036959	hsa-miR-548y	CLIP-seq
MIRT1036960	hsa-miR-559	CLIP-seq
MIRT1036937	hsa-miR-646	CLIP-seq
MIRT1036961	hsa-miR-649	CLIP-seq
MIRT1036869	hsa-miR-1205	CLIP-seq
MIRT2240089	hsa-miR-1231	CLIP-seq
MIRT1036874	hsa-miR-130a	CLIP-seq
MIRT1036875	hsa-miR-130b	CLIP-seq
MIRT1036876	hsa-miR-132	CLIP-seq
MIRT1036877	hsa-miR-148a	CLIP-seq
MIRT1036878	hsa-miR-148b	CLIP-seq
MIRT1036879	hsa-miR-152	CLIP-seq
MIRT1036880	hsa-miR-181a	CLIP-seq
MIRT1036881	hsa-miR-181b	CLIP-seq
MIRT1036882	hsa-miR-181c	CLIP-seq
MIRT1036883	hsa-miR-181d	CLIP-seq
MIRT2240090	hsa-miR-1972	CLIP-seq
MIRT1036940	hsa-miR-2117	CLIP-seq
MIRT1036887	hsa-miR-212	CLIP-seq
MIRT1036889	hsa-miR-301a	CLIP-seq
MIRT1036890	hsa-miR-301b	CLIP-seq
MIRT1036891	hsa-miR-30a	CLIP-seq
MIRT1036892	hsa-miR-30b	CLIP-seq
MIRT1036893	hsa-miR-30c	CLIP-seq
MIRT1036894	hsa-miR-30d	CLIP-seq
MIRT1036895	hsa-miR-30e	CLIP-seq
MIRT1036942	hsa-miR-3168	CLIP-seq
MIRT1036897	hsa-miR-3180-5p	CLIP-seq
MIRT2240091	hsa-miR-34c-3p	CLIP-seq
MIRT1036904	hsa-miR-3665	CLIP-seq
MIRT1036905	hsa-miR-3666	CLIP-seq
MIRT1036907	hsa-miR-4262	CLIP-seq
MIRT1036908	hsa-miR-4276	CLIP-seq
MIRT2240092	hsa-miR-4288	CLIP-seq
MIRT1036909	hsa-miR-4295	CLIP-seq
MIRT1036915	hsa-miR-454	CLIP-seq
MIRT2240093	hsa-miR-4650-5p	CLIP-seq
MIRT1036945	hsa-miR-4768-5p	CLIP-seq
MIRT1036930	hsa-miR-520a-5p	CLIP-seq
MIRT1036931	hsa-miR-525-5p	CLIP-seq
MIRT1036932	hsa-miR-543	CLIP-seq
MIRT2240094	hsa-miR-632	CLIP-seq
MIRT1036938	hsa-miR-657	CLIP-seq
MIRT2543770	hsa-miR-544	CLIP-seq
MIRT1036868	hsa-miR-1200	CLIP-seq
MIRT1036870	hsa-miR-1248	CLIP-seq
MIRT1036874	hsa-miR-130a	CLIP-seq
MIRT1036875	hsa-miR-130b	CLIP-seq
MIRT1036876	hsa-miR-132	CLIP-seq
MIRT1036877	hsa-miR-148a	CLIP-seq
MIRT1036878	hsa-miR-148b	CLIP-seq
MIRT1036879	hsa-miR-152	CLIP-seq
MIRT1036880	hsa-miR-181a	CLIP-seq
MIRT1036881	hsa-miR-181b	CLIP-seq
MIRT1036882	hsa-miR-181c	CLIP-seq
MIRT1036883	hsa-miR-181d	CLIP-seq
MIRT2543771	hsa-miR-204	CLIP-seq
MIRT2543772	hsa-miR-211	CLIP-seq
MIRT1036887	hsa-miR-212	CLIP-seq
MIRT2543773	hsa-miR-2276	CLIP-seq
MIRT1036889	hsa-miR-301a	CLIP-seq
MIRT1036890	hsa-miR-301b	CLIP-seq
MIRT2543774	hsa-miR-3074-5p	CLIP-seq
MIRT2543775	hsa-miR-3121-5p	CLIP-seq
MIRT1036896	hsa-miR-3124-3p	CLIP-seq
MIRT2543776	hsa-miR-3127-5p	CLIP-seq
MIRT2543777	hsa-miR-3145-5p	CLIP-seq
MIRT2543778	hsa-miR-3171	CLIP-seq
MIRT1036905	hsa-miR-3666	CLIP-seq
MIRT2543779	hsa-miR-3673	CLIP-seq
MIRT2543780	hsa-miR-3938	CLIP-seq
MIRT2543781	hsa-miR-4261	CLIP-seq
MIRT1036907	hsa-miR-4262	CLIP-seq
MIRT2543782	hsa-miR-4270	CLIP-seq
MIRT1036908	hsa-miR-4276	CLIP-seq
MIRT2543783	hsa-miR-4287	CLIP-seq
MIRT1036909	hsa-miR-4295	CLIP-seq
MIRT2543784	hsa-miR-4441	CLIP-seq
MIRT2543785	hsa-miR-4469	CLIP-seq
MIRT2543786	hsa-miR-4496	CLIP-seq
MIRT2543787	hsa-miR-452	CLIP-seq
MIRT1036915	hsa-miR-454	CLIP-seq
MIRT2543788	hsa-miR-4676-3p	CLIP-seq
MIRT2543789	hsa-miR-4685-3p	CLIP-seq
MIRT2543790	hsa-miR-4709-5p	CLIP-seq
MIRT2543791	hsa-miR-4760-3p	CLIP-seq
MIRT2543792	hsa-miR-4772-3p	CLIP-seq
MIRT2543793	hsa-miR-4795-3p	CLIP-seq
MIRT1036929	hsa-miR-515-5p	CLIP-seq
MIRT1036932	hsa-miR-543	CLIP-seq
MIRT2543770	hsa-miR-544	CLIP-seq
MIRT1036947	hsa-miR-548a-5p	CLIP-seq
MIRT1036948	hsa-miR-548ab	CLIP-seq
MIRT2543794	hsa-miR-548ac	CLIP-seq
MIRT2543795	hsa-miR-548ag	CLIP-seq
MIRT2543796	hsa-miR-548ai	CLIP-seq
MIRT1036949	hsa-miR-548ak	CLIP-seq
MIRT1036950	hsa-miR-548b-5p	CLIP-seq
MIRT1036951	hsa-miR-548c-5p	CLIP-seq
MIRT2543797	hsa-miR-548d-3p	CLIP-seq
MIRT1036952	hsa-miR-548d-5p	CLIP-seq
MIRT1036953	hsa-miR-548h	CLIP-seq
MIRT1036954	hsa-miR-548i	CLIP-seq
MIRT1036955	hsa-miR-548j	CLIP-seq
MIRT1036956	hsa-miR-548k	CLIP-seq
MIRT1036957	hsa-miR-548l	CLIP-seq
MIRT1036958	hsa-miR-548w	CLIP-seq
MIRT1036959	hsa-miR-548y	CLIP-seq
MIRT2543798	hsa-miR-548z	CLIP-seq
MIRT2543799	hsa-miR-549	CLIP-seq
MIRT1036960	hsa-miR-559	CLIP-seq
MIRT2543800	hsa-miR-563	CLIP-seq
MIRT1036936	hsa-miR-622	CLIP-seq
MIRT2543801	hsa-miR-628-5p	CLIP-seq
MIRT2543802	hsa-miR-642a	CLIP-seq
MIRT2543803	hsa-miR-664	CLIP-seq
MIRT1036868	hsa-miR-1200	CLIP-seq
MIRT1036874	hsa-miR-130a	CLIP-seq
MIRT1036875	hsa-miR-130b	CLIP-seq
MIRT1036876	hsa-miR-132	CLIP-seq
MIRT1036877	hsa-miR-148a	CLIP-seq
MIRT1036878	hsa-miR-148b	CLIP-seq
MIRT1036879	hsa-miR-152	CLIP-seq
MIRT1036880	hsa-miR-181a	CLIP-seq
MIRT1036881	hsa-miR-181b	CLIP-seq
MIRT1036882	hsa-miR-181c	CLIP-seq
MIRT1036883	hsa-miR-181d	CLIP-seq
MIRT2543771	hsa-miR-204	CLIP-seq
MIRT2543772	hsa-miR-211	CLIP-seq
MIRT1036887	hsa-miR-212	CLIP-seq
MIRT2543773	hsa-miR-2276	CLIP-seq
MIRT1036889	hsa-miR-301a	CLIP-seq
MIRT1036890	hsa-miR-301b	CLIP-seq
MIRT2543774	hsa-miR-3074-5p	CLIP-seq
MIRT2543775	hsa-miR-3121-5p	CLIP-seq
MIRT2543776	hsa-miR-3127-5p	CLIP-seq
MIRT2543777	hsa-miR-3145-5p	CLIP-seq
MIRT2543778	hsa-miR-3171	CLIP-seq
MIRT1036905	hsa-miR-3666	CLIP-seq
MIRT2543780	hsa-miR-3938	CLIP-seq
MIRT2543781	hsa-miR-4261	CLIP-seq
MIRT1036907	hsa-miR-4262	CLIP-seq
MIRT2543782	hsa-miR-4270	CLIP-seq
MIRT1036908	hsa-miR-4276	CLIP-seq
MIRT2543783	hsa-miR-4287	CLIP-seq
MIRT1036909	hsa-miR-4295	CLIP-seq
MIRT2543784	hsa-miR-4441	CLIP-seq
MIRT2543785	hsa-miR-4469	CLIP-seq
MIRT2543786	hsa-miR-4496	CLIP-seq
MIRT2543787	hsa-miR-452	CLIP-seq
MIRT1036915	hsa-miR-454	CLIP-seq
MIRT2543788	hsa-miR-4676-3p	CLIP-seq
MIRT2543789	hsa-miR-4685-3p	CLIP-seq
MIRT2543790	hsa-miR-4709-5p	CLIP-seq
MIRT2543792	hsa-miR-4772-3p	CLIP-seq
MIRT2543793	hsa-miR-4795-3p	CLIP-seq
MIRT1036932	hsa-miR-543	CLIP-seq
MIRT2543770	hsa-miR-544	CLIP-seq
MIRT1036947	hsa-miR-548a-5p	CLIP-seq
MIRT1036948	hsa-miR-548ab	CLIP-seq
MIRT2543794	hsa-miR-548ac	CLIP-seq
MIRT2543795	hsa-miR-548ag	CLIP-seq
MIRT2543796	hsa-miR-548ai	CLIP-seq
MIRT1036949	hsa-miR-548ak	CLIP-seq
MIRT1036950	hsa-miR-548b-5p	CLIP-seq
MIRT1036951	hsa-miR-548c-5p	CLIP-seq
MIRT2543797	hsa-miR-548d-3p	CLIP-seq
MIRT1036952	hsa-miR-548d-5p	CLIP-seq
MIRT1036953	hsa-miR-548h	CLIP-seq
MIRT1036954	hsa-miR-548i	CLIP-seq
MIRT1036955	hsa-miR-548j	CLIP-seq
MIRT1036956	hsa-miR-548k	CLIP-seq
MIRT1036957	hsa-miR-548l	CLIP-seq
MIRT1036958	hsa-miR-548w	CLIP-seq
MIRT1036959	hsa-miR-548y	CLIP-seq
MIRT2543798	hsa-miR-548z	CLIP-seq
MIRT2543799	hsa-miR-549	CLIP-seq
MIRT1036960	hsa-miR-559	CLIP-seq
MIRT2543800	hsa-miR-563	CLIP-seq
MIRT2543801	hsa-miR-628-5p	CLIP-seq
MIRT2543802	hsa-miR-642a	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7533895
GO:0000439	Component	Transcription factor TFIIH core complex	IBA
GO:0000439	Component	Transcription factor TFIIH core complex	IDA	8692841
GO:0000439	Component	Transcription factor TFIIH core complex	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	8652557, 10734143, 16793543, 18160537, 18354501, 19934020, 21670263, 21988832, 26278177, 32296183, 32814053, 33961781, 34591642
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005675	Component	Transcription factor TFIIH holo complex	IBA
GO:0005675	Component	Transcription factor TFIIH holo complex	IDA	9852112
GO:0005675	Component	Transcription factor TFIIH holo complex	IEA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	9118947
GO:0006289	Process	Nucleotide-excision repair	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006360	Process	Transcription by RNA polymerase I	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9118947
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	8692841
GO:0006974	Process	DNA damage response	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	NAS	15625236
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15625236
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IPI	15625236

MIM	HGNC	e!Ensembl
189972	4655	ENSG00000110768

P32780

Protein name

General transcription factor IIH subunit 1 (Basic transcription factor 2 62 kDa subunit) (BTF2 p62) (General transcription factor IIH polypeptide 1) (TFIIH basal transcription factor complex p62 subunit)

Protein function

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA

PDB

1PFJ , 2DII , 2RNR , 2RUK , 2RVB , 5GOW , 5XV8 , 6NMI , 6O9L , 6O9M , 7AD8 , 7BUL , 7DTI , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 7NVW , 7NVX , 7NVY , 7NVZ , 7NW0 , 8BVW , 8BYQ , 8EBS , 8EBT , 8EBU , 8EBV , 8EBW , 8EBX , 8EBY , 8GXQ , 8GXS , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08567	PH_TFIIH	16 → 97	TFIIH p62 subunit, N-terminal domain	Domain
PF03909	BSD	180 → 236	BSD domain	Domain

Sequence

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT

Sequence length

548

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors Nucleotide excision repair Viral carcinogenesis		Formation of RNA Pol II elongation complex Formation of the Early Elongation Complex Formation of Incision Complex in GG-NER Dual Incision in GG-NER RNA Polymerase II Pre-transcription Events Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER TP53 Regulates Transcription of DNA Repair Genes mRNA Capping RNA Polymerase I Transcription Initiation RNA Polymerase I Promoter Escape RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase I Transcription Termination RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Elongation RNA Polymerase II Transcription Initiation And Promoter Clearance RNA Pol II CTD phosphorylation and interaction with CE

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TERATOZOOSPERMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (181)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29974378, 31122822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30114705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22963397, 29897944, 31665193, 31810936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16405664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19557423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28055007, 29576851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27737765, 28223223, 30235892, 31243684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084127, 22972638, 23303844, 23417734, 23812289, 23884045, 24486447, 25114083, 25700176, 26302676, 26373655, 27016404, 27573878, 28076378, 28490746 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	20339559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	28924235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29153842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29770139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16874300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	30114705		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29328391, 29556265, 31849486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29383752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12700667, 23134379, 27345399, 27758045, 28968743, 29898994, 30324661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	23637164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15926199, 23192274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31050705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18692935, 30793399, 31698589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28924235, 36384536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36384536	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28498503, 29699801, 29844838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30094720		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9462237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11549587, 2574140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28006950, 28963374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11549587, 31183339		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	10699759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	10660593, 14726016, 16246722, 17466625, 18077223, 19008953, 21965540, 26149386, 31110295, 8465201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	24781187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19071211, 27573878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23421499, 28903368, 30275562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31040926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1874294, 2200214, 24065390, 30793399, 8461612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27031960, 30105541, 31260889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	17466625, 26149386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31501480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30729704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	9671271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19557423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	31064989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28935571, 30401435, 31466264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24492284, 29444469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse Panbronchiolitis	BEFREE	12185533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31714914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26162509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30306868, 30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28419832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28968997, 29251796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29414645, 30873635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30298448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19481605, 24042580, 26373655, 28490746, 30514811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22366791, 22674379, 22972638, 24252525, 25185840, 27573878, 30954537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22525272, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22525272, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22475378, 31444413, 31708690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17466625, 26149386		★★★★★ ★☆☆☆☆ Found in Text Mining only
HMN (Hereditary Motor Neuropathy) Proximal Type I	Hereditary Motor Neuropathy	BEFREE	8981949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21954231, 25311206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29171783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30460641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28968743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19071211, 27573878, 31107909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	19557423, 28159418, 31253480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	28076378, 28794251, 30742062		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	15926199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31802633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30094720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29732938, 30675758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	25412696		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30498063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30498063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29278715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29439841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190901, 11549587, 12118381, 21145819, 21482715, 24369267, 25026290, 2548435, 27211490, 27246794, 27404485, 28941211, 29311600, 29961754, 30793399, 31032410 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587, 31183339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31634464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24307700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18692935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24307700, 36384536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36384536	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12700667, 23134379, 27345399, 27758045, 28968743, 29898994, 30324661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26162509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31810986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31050705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 30793399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18692935, 30793399, 31698589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29439841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29699801, 29844838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10734072, 15538718, 16405664, 25103771, 29368435, 29383752, 29634950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	18470933, 18817897, 28125038, 28724634, 30231994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29328444, 30043279, 30158521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10190901, 11239393, 11549587, 12118381, 15221960, 15678607, 16405664, 18931699, 20974803, 22424619, 24888590, 24927592, 28512249, 28968743, 29088798 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23421499, 28903368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29786968, 31363726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27345399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	30339727		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28715145, 30581152, 30651597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28966079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28715145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29383752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	18346206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	22084127, 27016404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	23637164, 24252525, 25185840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24971696		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	17784878, 17931355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15926199, 1874294, 2188234, 2200214, 22424619, 23192274, 24065390, 24121124, 24475161, 24888590, 24927592, 25002027, 26268733, 26719575, 2679850 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22917563, 26509433, 28490746, 29535191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19071211, 19481605, 19557423, 26302676, 27573878, 28076378, 28975445, 30143980, 31818366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15926199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal intranuclear inclusion disease	Neuronal Intranuclear Inclusion Disease	BEFREE	31292692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22963397, 23769318, 29793508, 30145802, 30237564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27404485, 29276215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16517408, 28619261, 28966079, 29251796, 30588824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	12857745, 15765181, 16813535, 17052185, 18083707, 18481983, 18765443, 19589897, 19858527, 23417734, 24486447, 29555685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30740681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28915571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24639013, 29617702, 29928361		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29699801, 29844838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	19589897, 23417734, 29555685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22264792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15926199, 19557423, 28840510, 30055128, 30364275, 31501480, 31818366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31161648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31256441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19557423, 28794251, 31253480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28333129, 30623621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10734072, 15538718, 16405664, 25103771, 29368435, 29383752, 29634950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28006950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30977401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31810986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27031960, 30105541, 31260889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29328447		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31342626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30518408, 30538709, 31205465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27618275, 30877875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28724634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	24781187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29672276, 8981949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	25888134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	19788049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27706233, 28724634, 29439841, 30134604, 9462237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29551772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25714028, 29065309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31828418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15926199, 25826083, 28419832, 29515134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29328444, 30043279, 30158521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22138392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	28924235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28966079		★★★★★ ★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	10660593, 11062469, 11734544, 12393803, 12820975, 14726016, 15590337, 18077223, 18579452, 19008953, 19172752, 19808800, 19931493, 21730288, 22234153 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22638807, 23328664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29422639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	10064601, 10467415, 10660593, 11239393, 11734544, 11955452, 12393803, 12820975, 14726016, 16167068, 16947863, 18077223, 19008953, 19934020, 21571596 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum and Cockayne syndrome complex	Xeroderma Pigmentosum-Cockayne Syndrome Complex	BEFREE	16167068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	11242112, 20797633, 9427533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	9753735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group B	Xeroderma Pigmentosum	BEFREE	29959982, 8663148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group G	Xeroderma Pigmentosum	BEFREE	26149386		★★★★★ ★☆☆☆☆ Found in Text Mining only

GTF2H1 (general transcription factor IIH subunit 1)