GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene))

Gene

• Entrez ID: 2953
• Gene name: Glutathione S-transferase theta 2 (gene/pseudogene)
• Gene symbol: GSTT2
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be div

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028974	hsa-miR-26b-5p	Microarray	19088304
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq
MIRT2543690	hsa-miR-2116	CLIP-seq
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2543691	hsa-miR-4255	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2543692	hsa-miR-4677-5p	CLIP-seq
MIRT2543693	hsa-miR-4758-5p	CLIP-seq
MIRT2543694	hsa-miR-4776-3p	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	1417752
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	1417752
GO:0005829	Component	Cytosol	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 600437
• HGNC: 4642
• e!Ensembl: ENSG00000099984

Protein

• UniProt ID: P0CG29
• Protein name: Glutathione S-transferase theta-2 (EC 2.5.1.18) (GST class-theta-2)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:1417752). Has a sulfatase activity (PubMed:1417752).
• PDB: 4MPF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	5 → 75	Glutathione S-transferase, N-terminal domain	Domain
  PF00043	GST_C	86 → 199	Glutathione S-transferase, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells. {ECO:0000269|PubMed:8761485}.
• Sequence:

  MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
  DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
  PLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
  YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
  ARIP

• Sequence length: 244

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Megalencephalic leukoencephalopathy with subcortical cysts 1	Likely pathogenic	rs181983734	RCV003990068	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	29228969	Associate	★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	28704293		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29241580		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17250773		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17250773		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17250773	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	27766957	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30578782		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30578782		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29241580		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	CTD_human_DG	12868502		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18258609		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19265796	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19528963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19528963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
USHER SYNDROME, TYPE ID	Usher Syndrome	BEFREE	9653653		★☆☆☆☆ Found in Text Mining only