GSTT1 (glutathione S-transferase theta 1)

Gene

• Entrez ID: 2952
• Gene name: Glutathione S-transferase theta 1
• Gene symbol: GSTT1
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: The protein encoded by this gene, glutathione S-transferase (GST) theta 1 (GSTT1), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be div

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1036664	hsa-miR-1193	CLIP-seq
MIRT1036665	hsa-miR-1294	CLIP-seq
MIRT1036666	hsa-miR-3689d	CLIP-seq
MIRT1036667	hsa-miR-4450	CLIP-seq
MIRT1036668	hsa-miR-4710	CLIP-seq
MIRT1036669	hsa-miR-491-5p	CLIP-seq
MIRT1036664	hsa-miR-1193	CLIP-seq
MIRT2007348	hsa-miR-1264	CLIP-seq
MIRT1036665	hsa-miR-1294	CLIP-seq
MIRT2007349	hsa-miR-3199	CLIP-seq
MIRT1036666	hsa-miR-3689d	CLIP-seq
MIRT2007350	hsa-miR-4314	CLIP-seq
MIRT1036667	hsa-miR-4450	CLIP-seq
MIRT2007351	hsa-miR-4663	CLIP-seq
MIRT1036668	hsa-miR-4710	CLIP-seq
MIRT1036669	hsa-miR-491-5p	CLIP-seq
MIRT2007352	hsa-miR-635	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	9307035, 9434735, 20097269
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	9307035, 9434735
GO:0005515	Function	Protein binding	IPI	25910212, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	8799324
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	9307035, 9434735, 20097269
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 600436
• HGNC: 4641
• e!Ensembl: HGNC

Protein

• UniProt ID: P30711
• Protein name: Glutathione S-transferase theta-1 (EC 2.5.1.18) (GST class-theta-1) (Glutathione transferase T1-1)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutath
• PDB: 2C3N, 2C3Q, 2C3T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13417	GST_N_3	5 → 83	Glutathione S-transferase, N-terminal domain	Domain
  PF00043	GST_C	111 → 201	Glutathione S-transferase, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in club cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles. {ECO:0000269|PubMed:876
• Sequence:

  MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
  DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
  GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
  

• Sequence length: 240

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHENOZOOSPERMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA THALASSEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAYNAUD DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENILE CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS INSUFFICIENCY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	15862746, 16493615, 17339179, 23886197, 24194954, 24716937		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10673738, 10953966, 12827651, 14991750, 15382273, 15862746, 17339179, 18414197, 18444911, 20824655, 22215096, 23444902, 23725116, 24282086, 25102096, 30659796		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11230469, 20731606		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	15131792, 17592232, 27984487		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18035413, 21875282		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	18242955		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11740339, 12163326, 16195240, 22248273, 25036724, 8824506		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12163326, 15526353		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15526353, 17064856, 29599931		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	12682546, 8824506		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12163326, 14607333, 22248273		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10817498		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18093316		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11165755, 11773864, 16030123, 16365014, 22161138		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11773864		★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	26529288		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	15525789		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10673738, 10953966, 12827651, 14991750, 17339179, 18414197, 22215096, 25102096		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	12351375, 15194533, 20731606		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22484853		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12960134, 19391035, 21916526, 22475179, 22734843		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18952980		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	16874663, 9429231		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16496253		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21212706, 21701824, 23244519		★☆☆☆☆ Found in Text Mining only
Age-related cortical cataract	Cortical cataract	BEFREE	22665971		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	LHGDN	17524385		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	24902621		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22486522, 25542503	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	22813660, 25542503, 29072550		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	16618782		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	20663906		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	19096080, 19635899		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11719393	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	16173971	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25880856, 27885941	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	23590899, 25880856, 27885941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26186891		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	11977425		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24637631		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	11488937, 11719393, 14752874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic Anemia	Aplastic anemia	LHGDN	16227674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	12355548, 12859033, 22330623, 24407598, 28692121, 29658969		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20597111	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	17563610, 9055949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asbestosis	Asbestosis	CTD_human_DG	17563610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asbestosis	Asbestosis	Pubtator	33544514	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	CTD_human_DG	19303595		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	BEFREE	20056207		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	Pubtator	20056207	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	10840461, 11535245, 11862323, 15223862, 15300848, 15612961, 16164441, 16409207, 16550944, 17497028, 17711870, 20032267, 20073549, 21051083, 21109554, 22040239, 22484660, 22812193, 23076538, 23307299, 23600494, 23647087, 24559168, 27043549, 27372567, 29785881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15148962, 15300848, 15612961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	21109554, 27043549, 29785881, 35186174	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	7671227, 8824514, 9751255		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	9077484	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12355548, 12859033, 22330623, 24407598, 28692121, 29658969		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28692121	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30824761, 32892263, 35741737	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30824761		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	16386599		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	18190552, 27712026		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11737073	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18242955		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	18242955		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	18097510, 23026209, 23311983, 23877133		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	18097510	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	30732132		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21681823		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	15365958, 27568660, 31222646		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17064856, 17476458		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	16582078		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	16283344		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22766250		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	25325283		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19407363, 21089003, 21694442, 22692893		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20674986, 28043918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20674986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10783912, 10828664, 10840461, 11131031, 11757669, 11825664, 12429337, 12500666, 12552997, 14688016, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16005379, 17310693, 17340208, 17381051, 18544563, 18690546, 18979064, 19303722, 19380028, 20675267, 20942828, 21079384, 21286014, 21292509, 21586620, 22154357, 22339266, 23054023, 23886208, 24075358, 25284638, 27568660, 27631264, 27911277, 28403014, 28696895, 28696897, 29875071, 30419877, 30539835, 31009110, 9010594, 9544433, 9921921		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15764300, 15832776, 18365755, 19209780		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	20674986, 28043918		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15642394, 16874663, 22502694, 23661361, 25735248, 9429231		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	15642394		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23661361	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	18080216		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10564681, 10779639, 10862521, 10868690, 11303592, 11408954, 11585745, 11700265, 11731429, 11773866, 11792413, 12150456, 12175533, 12296511, 12430181, 12556960, 12835615, 12860276, 12873994, 12888106, 14562023, 14973092, 15090724, 15256483, 15280903, 15342448, 15538046, 15725614, 15808397, 16049806, 17180579, 17336217, 17693660, 18058229, 18425393, 18521819, 18542066, 18574688, 18618215, 19287154, 19440493, 19760040, 19921428, 20563767, 20728566, 21557334, 21559761, 21741269, 22126558, 22300440, 22564471, 23000097, 23227845, 23376175, 25648141, 25648260, 26400343, 26407578, 26572891, 26577857, 26681014, 27444273, 27785604, 28455582, 28747156, 29267651, 29445914, 30732156, 30803216, 9426059, 9539246		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12556960, 14562023, 17416769, 18425393, 18542066, 19469640, 20563767, 22564471, 22782090, 24535908, 25375048, 25648141, 26125851, 27444273, 29445914, 30803216, 32856852, 33503040, 38019237, 40156399	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	25263840		★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	15928955		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	20674986, 24120392, 28043918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19759907	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	19338664, 22393996, 23275251, 23679259		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10783912, 26434855, 31554367	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11564581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	20187096	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	20663906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16582078, 9077484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17505575	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15633230, 20683151, 25654087, 29582627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10783912, 10828664, 10840461, 11131031, 11757669, 11825664, 12429337, 12500666, 12552997, 14688016, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16005379, 17310693, 17340208, 17381051, 18544563, 18690546, 18979064, 19303722, 19380028, 20675267, 20942828, 21079384, 21286014, 21292509, 21586620, 22154357, 22339266, 23054023, 23886208, 24075358, 24240585, 24919441, 25284638, 27568660, 27631264, 27911277, 28403014, 28696895, 28696897, 29875071, 30419877, 30539835, 31009110, 9010594, 9544433, 9921921		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12668919, 22207034, 22296360, 24879623, 9456238		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10580025, 10616169, 10868696, 10952100, 11045782, 11473392, 11588132, 11740339, 11751442, 12175548, 12189190, 12690010, 12781423, 14534704, 14626895, 14666648, 15069685, 15105047, 15165083, 15184245, 15246186, 15258326, 15528218, 15646021, 15764294, 15801482, 16009381, 16228113, 16257343, 16509765, 16788248, 16939958, 17000715, 17016589, 17123660, 17307802, 17428572, 17428724, 18280004, 18415801, 18420450, 18463401, 19009239, 19124497, 19394866, 19669596, 20049629, 20428802, 20542754, 20729793, 20854097, 21791872, 22392686, 22525558, 22893352, 23013535, 23637998, 23794132, 23803127, 24072652, 24189890, 24326830, 24460270, 24460278, 24732639, 24852519, 25027082, 25036724, 25040976, 25388590, 26458582, 26529288, 27090234, 27099270, 27461642, 28315511, 28427236, 29076184, 30362324, 9029171, 9242470, 9276626, 9329644, 9434875, 9829708, 9918133, 9921921		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18768514, 22960333, 8956789	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	14504370, 27500405	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25472599	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21870186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10383895, 11044240, 11337940, 11535245, 16582078, 9077484, 9679566, 9950241		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11159743, 11328408, 12172391, 18768514, 19203783, 20966642, 22960333, 24532428, 25124586, 26803611, 27586145, 31081307, 8956789, 9751255, 9796976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	20663906		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	28500252	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12519635, 17448506, 20029178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17448506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	12879272		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12879272, 22330623, 24407598		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	15018031, 25566970		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	11040079, 15194507, 17514530, 22876127, 24754249, 26208492, 27706600		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	LHGDN	17514530		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22665971, 27706600	Associate	★☆☆☆☆ Found in Text Mining only
Cataract posterior polar 1	Congenital cataract	Pubtator	22665971	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22528457		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15004652, 15047208, 15661231, 16360200, 16631467, 18177825, 19640174, 21150818, 21166882, 21520994, 22631654, 26434855, 29909733, 31593112		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	11330960, 18090121, 21868558		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10813720, 15004652, 15047208, 15661231, 16360200, 16631467, 18177825, 19640174, 21150818, 21166882, 21520994, 22631654, 26434855, 29909733, 31593112		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10029576, 10666194, 10673738, 10953966, 12827651, 14991750, 15981231, 17339179, 18414197, 22215096, 24282086, 25102096, 9057653		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	20032267		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18952980		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	16874663, 9429231		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28521016, 28555163		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	31755784		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15492856, 18067039, 23034843, 24423050, 27498857		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20954980, 24216264, 31222646		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	30976200		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12010828		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	14662420		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15038404, 16977512, 17439673, 19017460, 19664521, 20402821, 20495862, 20842440, 21309732, 21651746, 21734345, 22160572, 29704242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	36833382	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15215328		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	16135950		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	18952980, 21734345	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21301992		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16217767, 16596290, 20688591, 23314736, 30106268, 9829708		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11448648, 24716977		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12210502		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24716977	Associate	★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	BEFREE	20056567		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10207630, 10424787, 10625170, 11165755, 11410321, 11487538, 12433710, 12530094, 15069679, 15637738, 15770723, 15932063, 16051638, 16829689, 16886896, 17191090, 18768509, 19798506, 19933708, 19960570, 20061204, 20207535, 20534171, 20688591, 20878130, 21916987, 22228187, 22234881, 22237425, 22296370, 22697302, 23773486, 24254297, 24842074, 25249451, 25408579, 27644629, 30106268, 30694518, 7614702, 8625505, 9829708		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12072547, 15637738, 18093316, 18630481		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15770723, 16217767, 18630481, 22228187, 25249451, 25408579, 26406947, 35674599	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24716977, 30356976	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30106268, 30694518	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10708971, 11535253, 14626895, 15093278, 15470755, 16424821, 16949064, 18394656, 19270789, 19481674, 19778234, 21193517, 21843791, 24290889, 24952511, 25395496, 26207596, 8901885, 9093388		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	21890078		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	25472599		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17182005		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10383153, 10794492, 11505222, 19424176, 21458313, 22054067, 22880812, 23717494, 24337975, 26656529, 27185341, 29884137		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12859033, 15088107, 17408703, 19055448, 19102712, 19419718, 19662515, 19823950, 20093049, 20354063, 21499713, 21848428, 22729902, 27215231, 27686690, 31396447		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12811412, 17408703, 18583868, 19102712		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12859033, 15088107, 16620396, 17408703, 18583868, 19055448, 19102712, 19662515, 19823950, 20093049, 20354063, 21352813, 21499713, 21848428, 22729902, 23570881, 27182613, 27215231, 27686690, 30039864		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16620396, 19419718, 27182613, 38508308	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10729397, 12859033, 14644396, 15088107, 17408703, 19055448, 19662515, 19823950, 20354063, 21499713, 21848428, 21890078, 22729902, 27215231, 27686690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cortical cataract	Cortical cataract	BEFREE	20335620		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21243434, 26604430, 28472806		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11352862, 21461548, 23184764, 23860951, 30883948		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15115915, 19097986, 22407040, 23758905, 24593045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	23758905, 24593045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	22686321		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	18325667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	30650146	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	14714091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	21176116, 26580648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	16002077, 16413497, 17979505, 24203463, 26125819		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	26823865	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16002077, 16413497, 16927413, 17979505, 23296061, 24203463, 26125819		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16927413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	20954980, 22058002, 22732554, 24053064, 24098457, 27908841, 36676788	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24053064, 27908841	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22058002, 22377702, 24098457, 33203728	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36834424	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18242955, 27908841		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15927971, 16413497, 17979505, 19102712, 20739761, 21352813, 22058002, 22330623, 22377702, 22652274, 22858312, 23014993, 24008019, 24098457, 24203463, 24685594, 26435566, 27173202, 28548478, 29111615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26252359, 29981844		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16523188, 26435566		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	15927971, 22377702, 31002594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	22377702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	19118072		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18203021, 22484853, 23391141, 28039708		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	11040079		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	15716609	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	24098457	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	11352862, 19484507		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21176116, 26580648		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	21734345	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15147044, 21558497, 9155064		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21558497	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11675474, 11730751, 12620480, 12875700, 15531593, 15861041, 15878920, 16291859, 17513317, 18805939, 23979901, 25208225, 25549292, 26350109, 26370772, 28002584, 31821471		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15059587, 17513317		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17513317, 25549292, 26350109, 27323100, 36013572	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24970787		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	12172391, 18768514, 19203783, 22960333, 27586145, 8956789, 9796976		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	20740495		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15526353, 17674367, 17916905, 20391126, 20409775, 20661821, 23167350, 23238916, 23244092, 23749488, 25432134, 28980936, 29215312, 29599931		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15526353, 17674367, 17916905, 20391126, 20409775, 20661821, 23167350, 23238916, 23244092, 23749488, 25432134, 28980936, 29215312, 29599931		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23244092, 23749488	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17173682, 20540773	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25432134	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	19782926, 21656129, 24788870		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25357227, 32188413, 35132887	Associate	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	16020292		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	16496253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	19917083, 22610071		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16173971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	17659824, 26548378		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	16760134, 31755784		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	16760134		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38376296	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	12767525, 8824506		★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	15801491		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	21508403		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19960570	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24124608		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24124608	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16874663		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	11040079, 15864623, 16973661, 18334963, 21151336, 23342067, 28710033, 30225227		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	16973661, 18334963	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	18334963, 25725180	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16973661, 18334963, 21738397, 25366778	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	16973661		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	28710033		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	16973661, 21738397, 23342067, 23747403, 23827458, 25366778, 30225227		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15006924, 16874663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	16874663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16874663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	15006924, 16874663		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16874663		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12540498, 16618782, 17372252, 22502694, 23079710, 23765968, 24122206, 9429231, 9641501		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20187096, 23765968	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	20663906	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26103006	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	21968078, 23792056		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	11740339		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	14688020, 14693745, 14724908, 16721740, 18074677, 18590468, 21133595, 21545198, 22918668, 23661016, 23886141, 25015263, 25724184, 9486585		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18094897, 20676536, 21133595, 21545198, 22918668, 36037119	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	31249357, 32435918	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	20812880, 32435918	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	11737073, 34193266	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28500252	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	15916660		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	29204680	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30537151		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34499222	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29204680		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	15018031		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	29619129	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26729828	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	20672371		★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	11737073, 19399747, 39863504	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	17087981, 17119063		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15338373		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	20661602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	12960134, 15368334, 19391035, 20977336, 21916526, 22475179, 22734843		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30662833		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23107763		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25357227, 28365671, 35132887	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25880856	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11477481, 17182005, 18300949, 18840420, 20073549, 21053180, 21656129, 21728793, 22330623, 24685594, 24788870, 24915237, 25357227, 25742618, 25880856, 30420646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17182005, 18300949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19419718	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	28500252	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	15579657, 21300689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	23079717		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	17676332		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29795558		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18952980		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	17919612, 20056207, 25532576	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	20056207, 22903474, 34806654, 36254890	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17565649, 18242955, 21243434, 26604430, 28472806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17565649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22732554	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24535908		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20517701		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18328165		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	18328165		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31445152		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15927971		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26158735	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18067039, 27498857	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15492856, 18067039, 23034843, 24423050, 27498857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	18067039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	20663906		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36013573	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15914211, 16938565		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12055050	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14607752, 18414197, 18610829		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16284498, 18414197, 21969307, 23444902, 26578531, 30659796		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12351375, 12468438, 12827651, 23725116, 23886197, 26960454, 36316809	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	21875282	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10815689, 11230469, 11488937, 11840286, 12351375, 12468438, 12827651, 15194533, 17023046, 17118447, 17339179, 17581325, 18035413, 18287869, 18414197, 18760837, 19811334, 20731606, 21942242, 24994605, 25145382		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12351375, 17118447, 18760837		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19555437, 20303013, 23812950		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	10334189, 14735473, 19718946, 21741876		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	10334189, 10571654, 16475728, 18507060, 21741876, 27152506		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	11246217, 11564581, 12016153, 15878757, 16475728, 16830058, 17418613, 19469619, 19953622, 21436184, 21545219, 21741876, 21875259, 23265943, 23444898, 23469236, 23609031, 24528041, 25595865, 25735346, 29037125, 30539845, 9367063		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11440964, 11470760, 12759747, 12907637, 14519756, 15633230, 15688397, 15734960, 16132793, 16314088, 18065725, 18816171, 20561699, 20672314, 21912475, 23053942, 23167353, 23185284, 23437305, 23959468, 24399650, 24852428, 26163595, 30976200		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15633230, 18816171		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15120366, 15215328, 17659824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19157724		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	26937962, 29582627	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	17465707		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29582627	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11018744		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21734345, 31554367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	8961976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	11844594, 14534704, 14666648, 15184245, 15246186, 16009381, 16228113, 18415801, 18472644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	15258326, 16788248, 19174490, 19394866, 19887610, 20156772, 20200426, 22392686, 23794132, 23803127, 24460270, 24506742, 24852519, 25040976, 27090234, 27275760, 30362324, 31554367, 32237725, 35381771, 36149146	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17000715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15934438, 16995867, 17195228, 18242955, 20226777, 25628002, 25648260, 27755947, 28711952		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22734843, 24586676		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38019237	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20029944	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12091121		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12091121, 12139735, 15725081, 22734843		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12091121		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	16874663, 23765968		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	14688020, 14693745, 14724908, 16721740, 18074677, 18590468, 21133595, 21545198, 22918668, 23661016, 23886141, 25015263, 25724184, 9486585		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	16697254, 21765044		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10564681, 10779639, 10862521, 10868690, 11303592, 11408954, 11585745, 11700265, 11731429, 11773866, 12150456, 12175533, 12296511, 12430181, 12556960, 12835615, 12860276, 12873994, 12888106, 14973092, 15090724, 15256483, 15280903, 15342448, 15538046, 15725614, 15808397, 16049806, 17180579, 17336217, 17693660, 18058229, 18425393, 18521819, 18542066, 18574688, 18618215, 19287154, 19440493, 19760040, 19921428, 20563767, 20728566, 21557334, 21559761, 21741269, 22126558, 22300440, 22564471, 23000097, 23227845, 23376175, 25648141, 25648260, 26400343, 26407578, 26572891, 26577857, 26681014, 27444273, 27785604, 28455582, 28747156, 29267651, 29445914, 30732156, 30803216, 9426059, 9539246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21558497, 9155064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12747608, 15526353, 17674367, 17916905, 20391126, 20409775, 20661821, 23167350, 23238916, 23244092, 23275251, 23749488, 25432134, 28980936, 29215312, 29599931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	16760134, 26925680, 31755784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16886896, 19960570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17479278, 17617661, 28403014, 9285043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	20663906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	11097350, 12359356, 12668919, 22207034, 22296360, 24879623, 9456238		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20683151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10580025, 10616169, 10868696, 10952100, 11045782, 11473392, 11588132, 11740339, 11751442, 12175548, 12189190, 12690010, 12781423, 14534704, 14626895, 14666648, 15069685, 15105047, 15165083, 15184245, 15246186, 15258326, 15528218, 15646021, 15764294, 15801482, 16009381, 16228113, 16257343, 16509765, 16788248, 16939958, 17000715, 17016589, 17123660, 17307802, 17428572, 17428724, 18280004, 18415801, 18420450, 18463401, 19009239, 19124497, 19394866, 19669596, 20049629, 20428802, 20542754, 20729793, 20854097, 21791872, 22392686, 22525558, 22893352, 23013535, 23637998, 23794132, 23803127, 24072652, 24189890, 24326830, 24460270, 24460278, 24732639, 24852519, 25027082, 25036724, 25040976, 25388590, 26458582, 26529288, 27090234, 27099270, 27461642, 28315511, 28427236, 29076184, 30362324, 9029171, 9242470, 9276626, 9329644, 9434875, 9829708, 9918133, 9921921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17000715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	11246217, 11564581, 12016153, 15878757, 16475728, 16830058, 17418613, 19469619, 19718946, 19953622, 21436184, 21545219, 21741876, 21875259, 23265943, 23444898, 23469236, 23609031, 23886141, 24528041, 25595865, 25735346, 29037125, 30539845, 9367063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	19338664, 22393996, 23275251, 23679259		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11159743, 11328408, 20966642, 24532428, 25124586, 26803611, 31081307, 9751255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10817498, 11854392, 19786118, 23184765, 23720024, 24528063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	10077151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10207629, 10643942, 11142418, 11275366, 11307147, 14968442, 15616829, 15638917, 15668493, 15756908, 16322300, 16466991, 16614120, 16720291, 17059341, 17572208, 18154451, 19143011, 19265530, 20056632, 20514077, 20599479, 20842440, 20884258, 21089003, 21243008, 21694442, 21705483, 22564066, 22692893, 22938433, 23189206, 23343819, 23365641, 23456766, 23817691, 23888321, 24508281, 24907267, 25198353, 26416453, 27268642		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11275366, 16998812, 17507624, 22564066		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20802377, 21967523, 23184764, 26295053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	26295053		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10667466, 11692073, 11819818, 12406553, 12767525, 14696128, 15112335, 15473001, 15688399, 15929164, 16517545, 16734729, 17996038, 18365908, 18398695, 19960261, 19960570, 20854097, 21167396, 21839153, 22471491, 22799358, 22952149, 22994755, 23167410, 23397542, 23512328, 23585855, 23949201, 23975364, 23979980, 24562622, 27039739, 27062139, 28198496		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12433731, 12536075, 15120911, 16427734, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10783912, 10828664, 10840461, 11131031, 11757669, 11825664, 12429337, 12500666, 12552997, 14688016, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16005379, 17310693, 17340208, 17381051, 18544563, 18690546, 18979064, 19303722, 19380028, 20675267, 20942828, 21079384, 21286014, 21292509, 21586620, 22154357, 22339266, 23054023, 23886208, 24075358, 24240585, 24919441, 25284638, 27568660, 27631264, 27911277, 28403014, 28696895, 28696897, 29875071, 30419877, 30539835, 31009110, 9010594, 9544433, 9921921		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10397466, 10580025, 10667466, 10673738, 10783912, 10794492, 10862521, 10868689, 11018744, 11131031, 11165755, 11230469, 11259393, 11408349, 11422615, 11446825, 11470992, 11819818, 11934439, 12368383, 12430181, 12435115, 12552971, 12579293, 12750240, 12811412, 14662420, 14735473, 14968442, 15004652, 15120911, 15165083, 15177664, 15368334, 15382272, 15588859, 15688399, 15808397, 15832776, 16217767, 16830058, 16911024, 17087981, 17140374, 17381051, 17418613, 17707637, 18177825, 18365908, 18771857, 19114965, 19223573, 19252342, 19270789, 19317600, 19376514, 19424176, 19424424, 20073549, 20514077, 20672314, 21079384, 21089003, 21558497, 21791872, 21798077, 21894447, 21969307, 22471491, 22692893, 23244106, 23275251, 23376175, 23810248, 23886141, 23994684, 24250808, 24452716, 24508281, 24535881, 24716977, 24913811, 25472599, 25640380, 27525908, 28365938, 28455582, 29111561, 29285301, 8625505, 8752158, 9298582, 9723026		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	25325283		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15004652, 15047208, 15661231, 16360200, 16631467, 18177825, 19640174, 21150818, 21166882, 21520994, 22631654, 26434855, 29909733, 31593112		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16217767, 16596290, 20688591, 23314736, 24716977, 30106268, 9829708		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12150456, 12296511, 12556960, 12860276, 16049806, 17693660, 18080216, 18425393, 18521819		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18952980		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18952980	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11352862, 17072629, 17342328, 19484507, 21461548, 21563941, 22251241, 23860951, 30883948		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16998606, 21461548	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	21461548	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	12540498, 22502694, 7671227, 9751255		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	18325667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Disorders, Severe	Mental Disorders	BEFREE	27114251		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	31739726, 35293017	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31739726		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15595630		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21694442	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	25445355		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10215103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	LHGDN	12016153		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	19884712, 21545219, 25735346, 28901451, 29037125, 30539845, 35751315	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15339690		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	15339690		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16949155, 17653713, 18061666, 18285692, 31681592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	16949155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17437619, 23932298, 26150166, 29055472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	22048269	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	10576500, 10815689		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10576500, 10616169, 10815689, 11488937, 12916871, 14752874, 15595630, 18493876, 19816935, 19843381, 23696026, 8569364, 9305616, 9723026, 9751255		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	14752874		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19843381	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16235982, 17420047, 18224491, 18414197, 19860557, 21969307, 22502716, 24659449, 24671854, 24913811, 25188725, 27454607, 30995900, 31111691		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27077777		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17823442, 22858312, 23275234		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17823442		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17823442	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21562205		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic Epilepsies, Progressive	Myoclonic epilepsy	BEFREE	26552558		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16550944, 19701760		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18628429, 19338664, 22393996, 23275251, 23679259, 23949879, 28952035		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18628429	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	22393996	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10498401, 11328408, 11448648, 11535245, 11700265, 11792413, 15006924, 15120911, 15382272, 15840612, 16427734, 16874663, 17384900, 18365908, 18507050, 19303722, 19568698, 19748847, 20187096, 20977336, 21079384, 21458313, 21545198, 21629772, 23469236, 23596512, 23661016, 23765968, 24411789, 24586676, 26577857, 26580399, 26782376, 27444273, 28455582, 30106268, 8824510, 9276622, 9751255, 9834266		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	25325283		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	15934438		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31445152		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	18594869		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	22445468		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	19555437, 23812950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21429837, 22011249		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15038404, 19362955, 20845989, 26722539, 27090234, 27525853, 27706763, 28572675		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26937962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	18186040		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	16874663, 9429231		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	18097510, 23026209, 23311983		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	20357201		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	19286687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral cleft	Oral cleft	BEFREE	11505167		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	18573513, 21358205, 22752755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	27527345	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35186174	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	22686321		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22048269, 24593045		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22048269	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14973099, 22471480, 22938445, 24689813, 27525908, 27721257		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22471480	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11159743, 11328408, 20966642, 24532428, 25124586, 26803611, 31081307, 9751255		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18768514		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11328408, 18768514, 34535163	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28365938	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10817498, 11854392, 19786118, 23184765, 23720024, 24528063		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22301281, 23184765	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	15131792, 15215328		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15215328		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12794689, 16047490, 25378345		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18591888, 24535271		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10215103, 10821441, 12524158, 18327668, 23045187, 23552977, 23982010, 24382428, 25086621, 25868597, 27216438, 31559607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17194543, 23982010, 32359946	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Penile hypospadias	Penile Hypospadias	BEFREE	15579657, 21300689		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	17069592, 17476458		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17524385		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	18952980, 36939926	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	21435719		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	21435719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural Diseases	Pleural diseases	Pubtator	33544514	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15333250		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33124502	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	22018952		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16365014		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	20957336		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26208492		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	14607752		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18414197, 23444902, 24282086, 30659796		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	18242955		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	12926131		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10207629, 11131031, 11142418, 11275366, 11307147, 14968442, 15616829, 15638917, 15668493, 15756908, 16322300, 16466991, 16614120, 16720291, 17059341, 17572208, 18154451, 19143011, 19265530, 20056632, 20514077, 20599479, 20842440, 20884258, 21089003, 21243008, 21694442, 21705483, 22564066, 22692893, 22938433, 23189206, 23343819, 23365641, 23456766, 23817691, 23888321, 24508281, 24907267, 25198353, 26416453, 27268642		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	19407363, 21694442	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11275366, 16998812, 17507624, 22564066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12663557, 15472409, 15616829, 17059341, 19917083, 21089003, 21694442, 22564066, 25198353, 36824501	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14968442, 15472409, 15616829, 17572208		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21705483	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35293017	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	21967523, 23489263, 27613512, 29067933		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	18186040, 27114251		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	26125819		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21309732, 21513434, 21734345, 27421065, 28951769	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24809844	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	20495862		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud Disease	CTD_human_DG	16977343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Phenomenon	Raynaud Phenomenon	CTD_human_DG	16977343		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	26406947		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	15932063		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17479278, 17617661, 28403014		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10383153, 10794492, 11505222, 14504370, 19424176, 21458313, 22054067, 22880812, 23717494, 24337975, 26656529, 27185341, 29884137, 9285043		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21651749		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	21651749		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	22377702		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21038299		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10364914, 15940757, 16870093, 19473562, 20401725, 20597111, 22510168, 23537991, 30873943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12879272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	27758991		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	19401526		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17586054, 19148781, 21093063, 23107768, 25358668, 26046920, 26175060, 26295386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19148781, 21093063, 22874804, 23107768, 25358668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	10815689		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	12072547		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	11511301, 17083362		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17284320	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17284320, 17431481		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	26295053		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	26295053	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12189190, 25036724, 26529288		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	18463401		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 11	Spinocerebellar ataxia	Pubtator	29619129	Associate	★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	26729828		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	10779639, 20563767		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10498401, 11740339, 12163326, 15069685, 15668931, 15878757, 15914211, 16195240, 16475728, 17221058, 18415801, 21166882, 21870186, 22248273, 23184764, 25036724, 8001244, 9029171, 9679751		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12748560, 16091114, 16618661, 17221058		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15801491, 17173682, 17916905, 20540773, 22216261, 23596512, 23731957, 25432134, 29599931		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	17173682		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16475728, 19401526, 21870186, 23469236, 25906090, 31244319, 31249357	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10371337, 10698480, 11447041, 11477586, 14688020, 14724908, 16618661, 17005168, 17119046, 17221058, 17653748, 18035380, 19401526, 19442564, 20568895, 21870186, 21957883, 23077643, 25167831, 25639971		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10667466, 11692073, 11819818, 12172927, 12406553, 12767525, 14696128, 15112335, 15473001, 15688399, 15929164, 16517545, 16734729, 17996038, 18365908, 18398695, 19960261, 19960570, 20854097, 20878561, 21167396, 21839153, 22471491, 22799358, 22952149, 22994755, 23167410, 23397542, 23512328, 23585855, 23949201, 23975364, 23979980, 24352702, 24562622, 27039739, 27062139, 28198496		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28182092	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14696128, 15688399, 16517545, 16886896, 18365908		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19610060, 20878561, 22471491, 22799358, 22994755, 25545243, 30726307	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11477481, 31637859		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	19424176, 22154357		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	26244436		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	19741569		★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	28837637		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12433731, 12536075, 15120911, 16427734, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	21086258		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	21086258	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12433731, 12536075, 15120911, 16427734, 18094897, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18591888, 19169061		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15368334, 18601742	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	21086258		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	22154357		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21243434, 21301992, 28472806, 8625505		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	20663906		★☆☆☆☆ Found in Text Mining only
Unverricht-Lundborg Syndrome	Myoclonic Epilepsy	BEFREE	26552558		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16135950		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	18094897	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10783912, 15832776, 18544563, 20675267, 21045267, 23886208, 24040330, 24240585, 24914957, 27568660, 28348449	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24919441	Inhibit	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	26158735	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21798077, 23159782		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20130515	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19640174, 20069434, 25663492, 26434855	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26785830		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	18163994, 19151739, 26782535		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous Insufficiency	BEFREE	22766250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	30095041	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	17568619, 19571817, 22681588, 24295891		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	19571817	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	29641697	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	17568619, 19571817, 22681588, 24295891		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	16874663, 9429231		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	14688016		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	15459223, 30883948		★☆☆☆☆ Found in Text Mining only