GSTP1 (glutathione S-transferase pi 1)

Gene

• Entrez ID: 2950
• Gene name: Glutathione S-transferase pi 1
• Gene symbol: GSTP1
• Synonyms (NCBI Gene): DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and st

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1695	A>G	Not-provided, drug-response	Missense variant, coding sequence variant
rs1555022268	TC>CA	Likely-pathogenic	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006966	hsa-miR-513a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22749944
MIRT006966	hsa-miR-513a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22749944
MIRT021715	hsa-miR-133a-3p	Reporter assay;Microarray	21396852
MIRT029320	hsa-miR-26b-5p	Microarray	19088304
MIRT049201	hsa-miR-92a-3p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Unknown	22580340
FOS	Unknown	8206948
JUN	Unknown	8206948
MBD2	Repression	11960994;12543808;19856314
MBD2	Unknown	11406558
NFKB1	Activation	15013838
RELA	Activation	15013838
SP1	Activation	8557630
TP53	Activation	18505928

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000302	Process	Response to reactive oxygen species	ISS
GO:0002674	Process	Negative regulation of acute inflammatory response	NAS	18962899
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	1540159, 9084911
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	16636664, 24965446, 25241761, 25416956, 31024008, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	1540159
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	1540159
GO:0007417	Process	Central nervous system development	TAS	9802272
GO:0008432	Function	JUN kinase binding	ISS
GO:0009636	Process	Response to toxic substance	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IC	16636664
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0015643	Function	Toxic substance binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	ISS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032355	Process	Response to estradiol	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	18962899
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18962899
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032872	Process	Regulation of stress-activated MAPK cascade	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	ISS
GO:0033591	Process	Response to L-ascorbic acid	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0035730	Function	S-nitrosoglutathione binding	IDA	11533048
GO:0035731	Function	Dinitrosyl-iron complex binding	IDA	11533048, 12871945
GO:0035732	Process	Nitric oxide storage	NAS	12871931
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043200	Process	Response to amino acid	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	NAS	18962899
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0045471	Process	Response to ethanol	IEA
GO:0046329	Process	Negative regulation of JNK cascade	IDA	16636664
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0048147	Process	Negative regulation of fibroblast proliferation	ISS
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0070026	Function	Nitric oxide binding	NAS	11533048
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	11408560
GO:0070664	Process	Negative regulation of leukocyte proliferation	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071460	Process	Cellular response to cell-matrix adhesion	IEA
GO:0071638	Process	Negative regulation of monocyte chemotactic protein-1 production	IDA	18962899
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IEA
GO:0097057	Component	TRAF2-GSTP1 complex	IDA	16636664
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	16636664

Other IDs

• MIM: 134660
• HGNC: 4638
• e!Ensembl: ENSG00000084207

Protein

• UniProt ID: P09211
• Protein name: Glutathione S-transferase P (EC 2.5.1.18) (GST class-pi) (GSTP1-1)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Particip
• PDB: 10GS, 11GS, 12GS, 13GS, 14GS, 16GS, 17GS, 18GS, 19GS, 1AQV, 1AQW, 1AQX, 1EOG, 1EOH, 1GSS, 1KBN, 1LBK, 1MD3, 1MD4, 1PGT, 1PX6, 1PX7, 1ZGN, 20GS, 22GS, 2A2R, 2A2S, 2GSS, 2J9H, 2PGT, 3CSH, 3CSI, 3CSJ, 3DD3, 3DGQ, 3GSS, 3GUS, 3HJM, 3HJO, 3HKR, 3IE3, 3KM6, 3KMN, 3KMO, 3N9J, 3PGT, 4GSS, 4PGT, 5DAK, 5DAL, 5DCG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	4 → 75	Glutathione S-transferase, N-terminal domain	Domain
  PF14497	GST_C_3	98 → 197	Glutathione S-transferase, C-terminal domain	Domain

• Sequence:

  MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
  LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
  KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
  VGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Sequence length: 210

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Prostate cancer
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation
Detoxification of Reactive Oxygen Species
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Kala-azar susceptibility 2	Likely pathogenic	rs1555022268	RCV000677248	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Abnormality of immune system physiology	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT LATE ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE MARROW DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMATOLOGICAL DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC INTRAEPITHELIAL NEOPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENILE CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL CALCULI	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESTIBULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	12540498		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	30488289		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11239504		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20623750		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	15862746, 24716937, 25799091		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10666194, 12439226, 12827651, 14991750, 15862746, 17696749, 18385010, 19256768, 20824655, 22930568, 25102096, 27299594, 30659796		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27984487		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21875282		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11550208, 11717336, 11740339, 11857497, 12010858, 12455028, 12937133, 15526353, 22248273, 23736019, 29344347, 9641498		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11550208, 12112555, 17646057		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	12670526, 9973204		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14607333		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11550208, 11717336, 11857497, 12010858, 12576869, 12855646, 15328191, 15649863, 17139617, 17373715, 26447830, 9641498		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18093316		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18093316		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11606500, 16030123, 16365014, 22161138, 23290999		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	12684406, 15042681, 15328191, 19470943, 20696638, 21116117, 22077694, 22511308, 23874531, 25738352, 25853848		★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	26529288		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	19357030, 21967547		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12827651, 14991750, 17696749, 18385010, 22930568, 25102096, 27299594		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	20731606		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	15003890, 15725081, 17508213, 18203021, 20303013		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	CTD_human_DG	11406608		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15788664, 19391035, 22475179		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	16496253, 21212706, 22487578		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16496253		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19084393		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	30238837		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	17181111		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	20210814		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	15888825		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	29072550		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	16109392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	16109392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	16109392		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	16109392		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	20187096		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	11196146		★☆☆☆☆ Found in Text Mining only
Anaplastic Ependymoma	Anaplastic Ependymoma	BEFREE	15102663		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	19635899, 23812950, 26033426		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	32711417, 33280607, 33326171	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	24840051, 25880856		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26186891		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28608594		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28608594		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19084393		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	16079101		★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	16973168		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18188076		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	LHGDN	18188076		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10806136, 11535245, 11686891, 11994713, 12204870, 14682402, 14748821, 15300848, 15544594, 15612961, 15693909, 16162701, 16176403, 16295782, 16456144, 16870661, 17088135, 17497028, 17643058, 17711870, 18057098, 18335111, 18511640, 18988661, 20032267, 20526719, 20858151, 21320344, 22040239, 22236719, 22326267, 22355322, 22812193, 23307299, 23357926, 23622008, 23647087, 24465030, 25895113, 26490046, 27043549, 27385593, 27561723, 29411558, 29557517		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11686891, 14682402, 14748821, 16295782, 17497028, 17711870, 18057098, 18335111, 18988661, 20526719, 21103062, 21320344, 22228263, 22355322, 22610343, 23066387, 23357926, 23600543, 23663310, 24465030, 25895113, 26490046, 27561723, 32943407	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	11994713, 15612961, 17643058, 18335111, 18988661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	11994713, 16870661, 18988661, 29411558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	11994713		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12241105, 21128213, 26580399		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	15102663		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20187096, 21128213, 26580399	Associate	★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	30951700		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	16295782		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	28182092	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	37347938	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	25101770, 27834815, 33546147, 35741737	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25101770, 25432440, 30824761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17404132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	32231024	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	25532576		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	25532576	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17508213, 18604726		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	15365959, 25111321		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	9973204		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17277236, 17476458, 19222528		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	17476458		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11085508, 11307147, 11708494, 11717336, 12010858, 14755684, 15289848, 15649863, 16323173, 16478744, 18004747, 18076912, 18242387, 18837951, 21631298, 22180037, 25738352		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	12127421		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11757669, 12500666, 12835616, 15780023, 15832776, 16399374, 17404387, 18365755, 18544563, 18569592, 18690546, 18979064, 19443378, 21117956, 21396852, 21669193, 22154357, 23054023, 23483487, 24075358, 24377535, 27631264, 30043549, 31646988		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	12500666, 22306368, 7729958		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15832776, 18365755, 18569592		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	25231845		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	31564827	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12241105, 15642394, 16899598, 25735248, 26429914		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	15642394		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24460273	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31123752, 32526700	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	11094302, 18080216		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10766427, 10779639, 10868690, 11059750, 11169956, 11303592, 11700265, 11773866, 12888106, 14973092, 15280903, 15342448, 15565566, 15784178, 16434992, 17180579, 17336217, 17416769, 17479284, 17549626, 17584018, 17624589, 17693660, 17696741, 17922231, 18058229, 18326615, 18425393, 18521819, 18542066, 18574688, 18618215, 18632608, 19379515, 19383894, 19440493, 19469640, 19760040, 19895170, 19921428, 20526737, 20668305, 20670164, 20696638, 20716965, 20728566, 21362365, 21559761, 21710692, 21837480, 22052985, 22300440, 22320983, 22564471, 23000097, 23227845, 23244102, 23334471, 23376175, 23826324, 24535908, 25008867, 25041782, 25155055, 25648141, 25674268, 25684485, 25773389, 25773813, 26125851, 26345960, 26400343, 26407578, 26452468, 26545608, 26572891, 26585467, 26681014, 26682223, 27323034, 27323180, 27785604, 28222671, 28438694, 28443466, 28747156, 28978147, 28979331, 29116019, 29693662, 30461653, 30585764, 30683915, 9407957, 9514046, 9524203, 9539246		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	20627767	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15565566, 16434992, 16672066, 17416769, 17611401, 17624589, 17683074, 17696741, 18326615, 18425393, 18485221, 18542066, 19379515, 19469640, 19921428, 19940364, 20568049, 20627767, 20696638, 20716965, 21454829, 21749698, 21837480, 22037257, 22052985, 22310978, 22320227, 22320983, 22564471, 22782090, 22986510, 23000097, 23244102, 23826324, 24093668, 24205493, 24535908, 25041782, 25119175, 25155055, 25375048, 25648141, 25674268, 26125851, 26452468, 26681014, 27323034, 27388253, 28222671, 28315507, 28443466, 28692125, 29116019, 30049201, 30461653, 30683915, 31450928, 32334487, 33064289, 33425072, 35729577, 35906899, 36308374, 37548362, 40156399, 7904475, 8206948, 9514046	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	30461653	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	22765268	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	10806136, 11686891, 16295782, 18057098		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	20526719, 22228263	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	25263840		★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	19484794		★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	15928955		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28081574		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15003890	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	22393996		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	10595928, 37347938	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12497653, 24377535, 24453034, 26476064, 30950439, 32183092, 40026294, 8546677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22298307, 27594734	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32592358	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11196146, 11555585, 11987150, 16230413, 16309193, 17278115, 7972132, 9511175, 9788592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	11196146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16582078	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	31450928	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12937151, 14507645, 17690210, 20080086, 20331903, 22536438, 22994742, 23437062, 23569432, 25892883, 25923138, 26000761, 26260272, 26476064, 29085212, 31731000	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29085212	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20056007, 24093668	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11757669, 12500666, 12835616, 15780023, 15832776, 16240451, 16399374, 17404387, 18365755, 18544563, 18569592, 18690546, 18979064, 19443378, 21117956, 21396852, 21669193, 22154357, 23054023, 23483487, 24075358, 24377535, 24919441, 27631264, 30043549, 31454540, 31646988		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	11477586		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10334644, 10376794, 11740339, 12019159, 12175548, 12189190, 12376472, 12640684, 12660004, 12711112, 12781423, 12894585, 14501269, 14628089, 15069685, 15105047, 15246186, 15528218, 15661806, 15896461, 16509765, 16788248, 16933328, 17123660, 17428572, 17428724, 17980933, 18258609, 18280004, 18415801, 19009239, 19174490, 19240225, 19282111, 19484794, 20729793, 22207177, 22525558, 22797821, 23013535, 23065248, 23184053, 23736019, 24566690, 24786234, 24935385, 25040976, 25122423, 26260621, 26458582, 26529288, 27525882, 27819744, 28739440, 29556330, 30539850, 31127915, 9918133		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	22765268		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22960333, 28365938, 30313031, 32711417	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17265526	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27500405, 33953831	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11511301	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12497653, 19047905	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10975609, 11535245, 15459020, 16582078, 17083362		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11159743, 12172391, 15086723, 15721406, 19203783, 20966642, 21480392, 22960333, 25124586, 27586145, 28365938, 30313031		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	11196146		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	30101629	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17479284		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33035787	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	LHGDN	16973168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	16973168		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12879272, 16973168, 22330623		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	16973168		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25566970		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	11040079		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	33599104	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	25231845		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12497653, 16631467, 28447725, 29909733		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12497653, 16631467, 28447725, 29909733		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10666194, 12827651, 14991750, 15717687, 17696749, 18385010, 22215096, 22930568, 23979883, 25102096, 27299594, 30210047		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	15544594, 16162701, 17643058, 17711870, 18335111, 20032267, 20210814, 24117884, 24465030, 25479314, 26490046, 29411558		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23065688		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12213730, 15467712, 15884115, 17550320	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15467712, 29774096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18067039, 24423050, 27498857		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18413200		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	18413200		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12010828		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10413721, 12153964, 14710442, 15161530, 15218992, 16919984, 16977512, 17439673, 19608716, 20467983, 21309732, 21651746, 21734345, 22339038, 31564855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	10413721, 12172904, 16977512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	36833382	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15120366, 15215328, 16157826, 16527261, 22536438, 26163595, 30254471		★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	33978213	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis, Cryptogenic	Cirrhosis	BEFREE	15120366		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	18159215		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21734345	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21301992		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24651583	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20688591, 21958378, 24970398		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	15122305	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30092668		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11487538, 11751682, 12072547, 15069679, 15122305, 15213713, 15637738, 15736440, 15770723, 15932063, 16230413, 16328000, 16395669, 16425401, 17404745, 18093316, 18768509, 18797455, 19643601, 19748847, 19922504, 20047135, 20207535, 20688591, 20878130, 21317201, 21490239, 21618522, 21711092, 22228187, 22697302, 22938488, 22994779, 23504587, 23811488, 24254297, 24842074, 24970398, 25408579, 25677447, 27154175, 27644629, 30694518, 31024008, 31653159		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12072547, 17404745, 18093316, 18797455, 19124514		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15122305, 15770723, 16369045, 16425401, 18093316, 18267032, 18797455, 19124514, 19922504, 20047135, 20216541, 22390411, 22697302, 22994779, 24762493, 26043078, 30356976, 31389389, 31740522, 33035787, 33280607, 35195960	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22158036		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30694518, 35674599	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23569432, 26040771, 26725685, 28676943		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15470755, 16537716, 17631926, 19778234, 24290889, 28770368		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28264803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	22815093		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28212715		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10383153, 14555992, 22054067, 23717494, 24337975, 27500405, 28284893, 29884137		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23570881		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21352813, 23160801, 23570881, 30039864		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31275451, 40485517	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22815093, 23570881		★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	10892871		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	23568549, 26427666		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	21169260, 26432087, 38013655	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12297838, 18976645, 19097986, 23758905, 24593045		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	12297838		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20140303, 23758905, 24593045	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	30973677		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28608594		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	23600543	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	14714091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	16162701, 19842992, 20674822, 26205459, 29624745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	18430527, 24203463		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16927413, 18430527, 24203463, 30488289		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16927413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22732554, 28585914, 34643502, 36676788, 40485517	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36674274	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26435566, 33203728, 34883250, 36674274, 36676788, 36834424, 40485517	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36834424	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20739761, 21352813, 22330623, 22377702, 22652274, 22858312, 23014993, 24008019, 24203463, 24685594, 26435566, 29111615, 29285015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26252359, 29981844		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	26435566		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22377702		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15003890, 15725081, 17508213, 18203021, 19239430, 20303013, 28039708		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	11040079		★☆☆☆☆ Found in Text Mining only
Disorder of macula of retina	Disorder Of Macula Of Retina	BEFREE	23404124		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28336260		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	14682402	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	25773813		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	20041472		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19842992, 20674822, 26205459, 29624745		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	17363767, 21734345	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15681469, 15837751, 20887769, 24068440		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15681469, 35893933	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15837751		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15531593, 15878920, 20047584, 22424617, 28002584, 31821471		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15878920		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22424617	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	12172391, 15086723, 19203783, 21480392, 22960333, 27586145, 30313031		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	20740495, 23828841		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15526353, 15788669, 16000570, 16338071, 17916905, 20391126, 20409775, 20661821, 20827430, 21286668, 25280543, 9829710		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15526353, 15788669, 16000570, 16338071, 17916905, 20391126, 20409775, 20661821, 20827430, 25280543, 9829710		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15788669, 16000570		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20540773, 30499150	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22853296	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	20459448		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	18215156		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	CTD_human_DG	18215156		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	16020292		★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	17548864, 20140303		★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	16973168		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15467712		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	16496253, 22487578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11696442, 11751372, 11795433, 18004747, 18837951, 19917083, 25753984		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	17277236, 19222528		★☆☆☆☆ Found in Text Mining only
Familial Tremor	Tremor	CTD_human_DG	18215156		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16173971		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30951700		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	16760134		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	16760134		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38554336	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	15801491		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14507661	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	29434449	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29434449		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	16995867	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	16170165		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	24205873		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	11040079, 15864623, 23342067		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	21738397	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	33599104	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	21738397, 23342067		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18584351		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21128213, 24532427, 26580399, 28965273, 30321868		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21128213, 24532427, 32526700	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30321868	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33087132	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21128213, 23079710, 24532427, 28965273		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10760946, 12540498, 15642394, 17372252, 22795327, 23079710, 23975366, 30952719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	16899598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid-remediable aldosteronism	Hyperaldosteronism	BEFREE	24457959		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	22487578		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	15003890		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12148855, 14693745, 18590468, 21545198, 22799388, 22918668, 23144854, 23661016, 24452716, 30870506		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	14678959		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21545198, 22799388, 22918668, 28686330, 30950439, 32592358	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	23065688, 36397425	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36397425	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	21887680	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28212715		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31275451	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	17409936, 21169260, 22868256, 37058477	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30537151		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	26354850	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	25293352		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	25293352, 26121922		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	32541641	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26790967	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22320227, 35729577	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	23569432	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39684755	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30049201	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21133646, 21364753		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	17119063, 18768509		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	21973220, 28212552		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	20661602		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	CTD_human_DG	11406608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	15788664, 18768784, 19391035, 20977336, 22475179		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	15788664	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin lymphoma, lymphocyte depletion	Hodgkin Lymphoma, Lymphocyte Depletion	CTD_human_DG	11406608		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	23600543	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	20592457, 24915237	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	20592457, 24915237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	24915237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	30765895	Associate	★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	16157826		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	23079717		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33640700, 36709476	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	22903474	Inhibit	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	25532576	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	22903474, 25532576, 34806654, 36254890	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25895113	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22732554	Associate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	16973168		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	28182092	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	22359287		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	15467712		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	17479284, 24535908		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18328165		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	CTD_human_DG	24360074		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	12868187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	31357662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	18067039, 27498857	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20623750		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	18067039, 24423050, 27498857		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	18067039		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11239504, 16284498, 21453686, 26578531, 30659796		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11553769, 23082001	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	15003890	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11553769, 23886197, 25799091, 26823947, 26960454, 37302023	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19811334, 21156465, 24854448, 25145382, 26823947		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19332728, 21169260, 23812950		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	17886251		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	27152506		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10780269, 17418613, 17886251, 19953622, 21545219, 21875259, 23471163, 29037125		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10717233, 11948118, 11960994, 12895264, 12937151, 14507645, 15763338, 15808399, 16527261, 16613325, 17214331, 17534893, 17716224, 18351580, 18691570, 20112070, 20331903, 21146512, 22536438, 22994742, 23053942, 23569432, 23765758, 25853848, 25892883, 25923138, 26125884, 26163595, 26260272, 26682223, 26883180, 27271262, 29305565, 29507666, 29970711, 30254471, 31731000, 3359415		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	11960994, 14714299, 17716224		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	9029167		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15120366, 15215328, 16157826, 16316639, 16527261, 18691570, 22536438, 25923138, 26163595, 30254471		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33291080	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	15215328, 19157724		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	26040771, 28676943		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	25293352	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	10357778, 14748821, 15888825, 20082271, 22339038, 28212552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	21734345, 28212552	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	11844594, 12189190, 12376472, 12789263, 14501269, 14628089, 15900595, 17234469, 17409824, 17428572, 17980933, 18415801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	16342067, 16788248, 16933328, 19174490, 19282111, 19484794, 19887610, 20156772, 22206016, 24786234, 25040976, 25105437, 25122423, 27819744, 27903892, 28739440, 31127915, 31554367, 32648197, 34596453, 35469493, 36709476	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17909032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	19118009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18288203		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16995867, 17195228	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18288203		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15934438, 16995867, 17195228, 24981927		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27002825	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28976264		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18485221, 22320983, 23826324, 27388253, 36454866	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocyte Rich Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	11406608		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15003890, 22734843, 30537151		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15231573, 23082001	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15003890	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15003890, 17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	11406608, 12091121, 12397416		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11406608, 12091121, 12397416, 15725081, 19822571, 19899130		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	15585627		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11406608, 12091121, 12397416, 19822571		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	18768509		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	16899598		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12148855, 14693745, 18590468, 21545198, 22799388, 22918668, 23144854, 23661016, 24452716, 30870506		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18604713		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21765044		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	16030117		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10766427, 10779639, 10868690, 11059750, 11169956, 11303592, 11700265, 11773866, 12888106, 14973092, 15280903, 15342448, 15565566, 15784178, 16434992, 16791478, 17180579, 17336217, 17416769, 17479284, 17584018, 17624589, 17693660, 17696741, 17764884, 17922231, 18058229, 18326615, 18425393, 18521819, 18542066, 18574688, 18618215, 19379515, 19383894, 19440493, 19469640, 19760040, 19895170, 19921428, 20526737, 20668305, 20670164, 20696638, 20716965, 20728566, 21362365, 21559761, 21710692, 21837480, 22052985, 22300440, 22320227, 22320983, 22564471, 23000097, 23227845, 23244102, 23334471, 23376175, 23826324, 24324107, 24535908, 25008867, 25041782, 25155055, 25648141, 25674268, 25684485, 25773389, 25773813, 26125851, 26345960, 26400343, 26407578, 26452468, 26545608, 26572891, 26585467, 26681014, 26682223, 27323034, 27323180, 27785604, 28222671, 28438694, 28443466, 28692125, 28747156, 28978147, 28979331, 29116019, 29693662, 30461653, 30585764, 30683915, 9407957, 9524203, 9539246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15837751, 24068440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15526353, 15788669, 16000570, 16338071, 17916905, 20391126, 20409775, 20540773, 20661821, 20827430, 25280543, 9829710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	16760134		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31281468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	10067818, 11477586, 12359356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21453686, 29507666, 31357662		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10334644, 10376794, 11740339, 12019159, 12175548, 12189190, 12376472, 12455028, 12467239, 12640684, 12660004, 12711112, 12781423, 12894585, 14501269, 14628089, 15069685, 15105047, 15246186, 15528218, 15661806, 15896461, 16509765, 16788248, 16933328, 17123660, 17428572, 17428724, 17980933, 18258609, 18280004, 18415801, 19009239, 19174490, 19240225, 19282111, 19484794, 20729793, 22207177, 22525558, 22797821, 23013535, 23065248, 23184053, 23736019, 24566690, 24786234, 24935385, 25040976, 25122423, 26260621, 26458582, 26529288, 27525882, 27819744, 28739440, 29556330, 30539850, 30890751, 31127915, 9918133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17909032		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10376763, 10780269, 17418613, 17886251, 19953622, 21545219, 21875259, 23471163, 29037125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	22393996		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	23523331		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11159743, 15721406, 20840667, 20966642, 25124586, 28365938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17265526, 19786118, 24528063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	10077151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10022813, 10471065, 10779522, 10970725, 11085508, 11295593, 11307147, 11406558, 11434510, 11555585, 11696442, 11708494, 11717336, 11748358, 11751372, 11796315, 11850822, 11912447, 11948476, 11987150, 12010858, 12518868, 12576869, 12855646, 14572750, 14755684, 14972513, 15126784, 15172996, 15195126, 15289848, 15328191, 15474280, 15490975, 15527908, 15530476, 15538743, 15542263, 15638917, 15649863, 15668493, 15800905, 15930338, 16166436, 16170165, 16235991, 16399374, 16446401, 16614120, 16803634, 16921492, 17059341, 17067754, 17108217, 17363525, 17415778, 17453001, 17548691, 17558856, 17606710, 17965617, 18072598, 18076912, 18154451, 18242387, 18257117, 18339699, 18837951, 19138839, 19143011, 19229700, 19265530, 19459176, 19470943, 19856314, 20056632, 20067451, 20606036, 21098650, 21116117, 21243008, 21631298, 21654682, 21839064, 21855532, 21947551, 21980513, 22052999, 22161815, 22172496, 22180037, 22511308, 22833520, 22999998, 23189206, 23494181, 23621580, 23843029, 23874531, 23977100, 23979608, 24141771, 24610081, 24769028, 25144624, 25251951, 25577235, 25738352, 26086362, 26447830, 26475336, 27576364, 27594734, 27996157, 28084441, 28653607, 28917266, 29305565, 29453167, 29571584, 29660369, 30357756, 30466891, 30470249, 31263949, 31666119, 31837464, 7972132, 9184779, 9641498		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11196146, 15538743, 17173048, 19223546, 22581815		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15999103, 26044055		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11562107, 11692073, 12695555, 12746473, 15473001, 15856451, 16317430, 17593927, 19157859, 20377137, 22471491, 22517484, 22799358, 22952149, 22994755, 23077566, 23098455, 23456768, 23604281, 26279301, 28198496, 29434449		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21133646, 21364753		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	31107374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12536075, 15120911, 15159014, 19169061, 22765906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11757669, 12500666, 12835616, 15780023, 15832776, 16399374, 17404387, 18365755, 18544563, 18569592, 18690546, 18979064, 19443378, 21117956, 21396852, 21669193, 22154357, 23054023, 23483487, 24075358, 24377535, 24919441, 27631264, 30043549, 31454540, 31646988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	12500666, 22306368, 7729958		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10376763, 10536361, 10741511, 10868687, 11122850, 11307147, 11408349, 11597790, 11948118, 12148855, 12189190, 12241105, 12435115, 12448005, 12576869, 12855646, 12883749, 15003890, 15126784, 15159014, 15172996, 15382272, 15623627, 15832776, 15999103, 16256792, 16338071, 16773633, 1684084, 16886896, 16918316, 16921492, 17192910, 17278115, 17558856, 17593093, 17624589, 17707637, 17886251, 18070176, 18072598, 18199464, 18569592, 18771857, 19223573, 19424176, 19618282, 20056632, 20526737, 20854097, 21098650, 21116117, 21545198, 21669193, 21805023, 22077694, 22158036, 22172496, 22339038, 22797821, 23104734, 23334471, 23419314, 23437223, 23765758, 23994684, 24464224, 24535881, 24610081, 24769028, 25041782, 25773813, 26125884, 26580399, 27185638, 27525908, 28410197, 28739440, 29285301, 29305565, 29501922, 29609141, 29959055, 30043549, 30290218, 30499150, 30740061, 31019568, 31107374, 31243599, 31611630, 31666119, 7728947, 8546677, 9511178		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	9511175		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	31107374		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12497653, 16631467, 28447725, 29909733		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20688591, 24970398		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	40284160	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12543808, 12943817, 15375523, 17479284, 17584018, 17624589, 17693660, 17696741, 17922231, 18095031, 18326615, 18425393, 18521819		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28692125		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	25322848		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	14719182		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	22048975		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12684707		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23065688	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15999103, 17342328, 19484507, 22251241, 23568549, 26044055, 26427666		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15999103, 17342328		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15999103, 9877184	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26427666	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15642394, 22288845, 26580399		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28608594		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31357662		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33544514	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31611630	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mixed Cellularity Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	11406608		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	16899598		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23953887		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	26295823		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12937133	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28182092	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17886251		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17886251, 21545219, 29037125, 32265484, 36149156	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15003890, 15339690		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	25589620	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	1684084, 19047905		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12791655, 17512053, 18061666, 23953887, 26743341		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12791655		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12791655, 32937189	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24588223, 25231845, 26150166, 30063300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	25231845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	30063300	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19027952, 23278642		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20843134, 24659449, 25188725, 25436036, 27454607, 31111691		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	20843134		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	27077777		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17823442, 21504558, 22858312		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24915237	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	12937133	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	37347938	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19701760		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11921287, 21874234, 22393996		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27149165	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	22393996, 27149165	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	30870506	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	14710442	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26426434		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10975609, 11406608, 11477586, 11601682, 11696442, 11751372, 12019159, 12154064, 12241105, 12397416, 12455028, 12518868, 12684406, 12692786, 12850376, 12895264, 14572750, 14693237, 14734448, 15074394, 15086723, 15120911, 15126784, 15129426, 15289362, 15467712, 15499621, 15623627, 15808399, 16230413, 16478744, 16527261, 16773633, 16791478, 16803634, 1684084, 17278115, 17532092, 17548691, 17764884, 18085999, 18425080, 18505928, 19254954, 19379515, 19391035, 19741569, 19748847, 19895170, 19953622, 20338046, 20470789, 20654585, 21116117, 21128213, 21396852, 21545198, 21830905, 21947551, 22077694, 22320227, 22517484, 23065688, 23144854, 23771052, 23874531, 24068440, 24086370, 24093668, 25155055, 25418895, 25773813, 26125851, 26195723, 26429914, 26447830, 26452468, 26585467, 27154175, 28222671, 28447725, 28653607, 28978147, 29507666, 29774096, 30043549, 30153423, 30254471, 30585764, 30683915, 7857716, 9825836		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30321868		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	18594869		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	19922504, 20308030	Associate	★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	14654541		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10536361, 11601682, 22045684, 22202125, 27197232		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31357662		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24205873		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	12883734		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	12883734		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29426343		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	BEFREE	12883734		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	16707601, 19922504, 20308030, 23695028		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	19332728, 21169260, 23812950		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	21169260, 22868256, 30927276, 35729577, 38013655	Associate	★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	11406608		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21429837, 22011249, 23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10493307, 11196170, 12455028, 12841866, 16195240, 17409936, 19362955, 19568750, 20845989, 22009704, 22761669, 24729086, 24935385, 24958519, 26028097, 26033426, 26097600, 26345972, 26722539, 26823821, 27173276, 27323109, 27525853, 27706763, 28442702, 28717179, 29254785, 30341887		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17094902		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30951700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17479284, 21710692		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15729709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	15729709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nuclear cataract	Cataract	BEFREE	27348130		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	27348130		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21266224	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28203716, 28561194		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	24324107, 9524203		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	15102663		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	23324581, 25532576		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	23523331		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	23523331	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24593045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	24593045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis with pseudoglioma	Osteoporosis-Pseudoglioma Syndrome	BEFREE	8659519		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CTD_human_DG	17152492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	17513610, 22068640, 22938445, 23317281, 24689813, 24841650, 24996541, 27525908, 30909663		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	17513610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	21887680, 22068640, 22938445, 23317281, 24841650, 24996541, 27525908	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	11159743, 15086723, 15721406, 20966642, 25124586, 28365938, 28692125		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11783115		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16773633, 25010864, 33273524, 36988399	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	23647087		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17265526, 19786118, 24528063		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17265526		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17265526		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31602160, 31611630	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	15215328		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15215328		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34130200	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12794689, 15215328, 17548864		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	20553257		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12524158, 15288444, 17034008, 17190945, 17250723, 20461808, 23857610, 31559607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	17190945, 23721876		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	23857610	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	27759448	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	17069592, 17476458, 20459448		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	LHGDN	17476458		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25041782		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	19223573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	19223573, 36939926	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20979931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	16484137, 19223573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pilocytic Astrocytoma	Astrocytoma	BEFREE	12684707		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18425080		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	18425080, 30321868	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	22031394	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	22031394		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16365014		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10666194, 19256768, 27299594, 30659796		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12439226, 15717687, 17696749		★☆☆☆☆ Found in Text Mining only
Progressive bulbar palsy	Bulbar palsy	BEFREE	26295823		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	12926131		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10022813, 10471065, 10779522, 10970725, 11085508, 11295593, 11307147, 11406558, 11434510, 11555585, 11696442, 11708494, 11717336, 11748358, 11751372, 11796315, 11850822, 11912447, 11948476, 11987150, 12010858, 12518868, 12576869, 12855646, 14572750, 14755684, 14972513, 15045584, 15126784, 15172996, 15195126, 15289848, 15292941, 15328191, 15474280, 15490975, 15527908, 15530476, 15538743, 15542263, 15623627, 15638917, 15649863, 15668493, 15800905, 15930338, 16166436, 16235991, 16399374, 16446401, 16614120, 16803634, 16921492, 17059341, 17067754, 17108217, 17291695, 17363525, 17415778, 17453001, 17548691, 17558856, 17606710, 17965617, 18072598, 18076912, 18154451, 18242387, 18257117, 18339699, 18837951, 19138839, 19143011, 19229700, 19265530, 19459176, 19470943, 19856314, 20056632, 20067451, 20606036, 21098650, 21116117, 21243008, 21631298, 21654682, 21839064, 21855532, 21947551, 21980513, 22052999, 22161815, 22172496, 22180037, 22511308, 22833520, 22999998, 23189206, 23494181, 23621580, 23843029, 23874531, 23977100, 23979608, 24141771, 24610081, 24769028, 25251951, 25577235, 25738352, 26086362, 26447830, 26475336, 27576364, 27594734, 27996157, 28084441, 28653607, 28917266, 29305565, 29453167, 29571584, 29660369, 30357756, 30470249, 31263949, 31666119, 31837464, 7972132, 9184779, 9641498		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	21631298		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	22180037, 27511358, 37781794	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	10595928, 16446401, 37347938	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	27594734	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	11550208		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	11795433, 12010858, 14607218, 14755684, 15195126, 17558856, 21116117, 27594734, 9641498		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	22581815		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10779522, 11696442, 11748358, 12499435, 16235991, 16446401, 16803634, 17059341, 17067754, 17453001, 17965617, 18072598, 18076941, 18500686, 19229700, 19265530, 19470943, 19917083, 20860828, 21694441, 21822036, 21830905, 21839064, 21980513, 22052999, 22077694, 22180037, 22376260, 22672250, 22833520, 22859398, 23146971, 23874531, 24769028, 25251951, 25738352, 25753984, 26011342, 26086362, 26195723, 26447830, 27457352, 27511358, 27576364, 27594734, 28084441, 29660369, 30357756, 30373654, 30470249, 31115550, 31337649, 31666119, 32183092, 34581895, 35293017, 37347938, 37781794, 38493315, 7972132	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11196146, 15538743, 17173048, 19223546, 22581815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11555585, 11708494, 11796315, 11850822, 15822191, 16921492, 17415778, 18500686, 22085526, 29017567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11751372, 12746833, 15328191, 15527908, 15538743, 16478744, 17067754, 17291695, 17453001, 17960617, 18413363		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18257117, 21622623, 25144624	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	23647087		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26967570		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	15729709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	15729709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	10413721, 14710442, 15218992, 20467983, 20525719, 21309732, 21734345, 22976395, 24670356, 27193053, 31564855, 34707353, 36808722	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	34883250	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	28212552	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	17363767, 21734345		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18540691, 20688591		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10383153, 14555992, 22054067, 23717494, 24337975, 28284893, 29884137		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28212715		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18335111		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	18335111, 33035787	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22278416	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10364914, 15940757, 16870093, 19473562, 23053970		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	27561723		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	27561723	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	23663310	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	17181111		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	39201484	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	20082271		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	CTD_human_DG	17152492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma, Epithelioid	Sarcoma	CTD_human_DG	17152492		★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	CTD_human_DG	17152492		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	19401526		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12691788, 16039055, 21093063, 25358668, 26295386, 28872562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12691788, 25358668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	18797455, 20216541		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35681439	Associate	★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	PSYGENET_DG	15729709		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	17083362		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16848913, 17284320, 39873985	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17108810, 17284320, 21805023		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	11511301	Associate	★☆☆☆☆ Found in Text Mining only
Skin Ulcer	Skin ulcer	Pubtator	33280607	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12189190, 21766492, 22339038, 26529288		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	10779639, 16835078		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10376763, 11044240, 11511301, 11740339, 15526353, 15668931, 17083362, 20729138, 22248273, 23184053, 29875076, 30378178, 30665373, 9511175		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	14678959, 15254763, 17160265		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11008209, 15801491, 16492918, 17916905, 19618282, 20391126, 20409775, 20540773, 22216261, 22853296, 30499150, 31019568, 9761122		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17179690, 19401526, 23523331, 25906090, 31249357, 32592358	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	12711112, 22089643		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	23523331		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10698480, 11477586, 12148855, 12478542, 15254763, 16618661, 17119046, 17179690, 18035380, 19401526, 19406142, 20568895, 21704413, 25639971, 29348462, 30973677		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	19047905		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11562107, 11692073, 12695555, 12746473, 15473001, 15856451, 16317430, 17593927, 19157859, 20377137, 22471491, 22517484, 22799358, 22952149, 22994755, 23077566, 23098455, 23456768, 23604281, 26279301, 28198496, 29434449		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28182092	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12695555, 12746473, 15831994, 15856451, 16309193, 17322540, 17646057, 20514304, 22517484, 23077566, 24453034, 25545243, 26768611, 28198496, 29434449, 33620602	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	18365908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18365908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21133646, 21364753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26768611	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	18199464, 19424176, 31454540		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	19741569		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	19741569		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	LHGDN	18162130		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	33326171	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	20592457		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	20592457	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35361071	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	17980001		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12536075, 15120911, 15159014, 19169061, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12536075, 15120911, 15159014, 19169061, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15159014, 17133316		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	15159014		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	30765895	Stimulate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	24205873	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	16112301		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25684485, 27185638, 28978147		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25684485, 35729577	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21234761, 21301992, 24651583, 28922365		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	11196146		★☆☆☆☆ Found in Text Mining only
Ureteral Calculi	Ureteral Calculi	CTD_human_DG	24360074		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary Bladder Diseases	LHGDN	17469025		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15780023, 18544563, 19443378, 22306368, 24040330, 24377535, 24919441, 26354850, 31646988	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	15832776, 9164845	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24919441	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	26158735	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	16639696, 24377553		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12497653, 20069434, 29479986	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31275451	Associate	★☆☆☆☆ Found in Text Mining only
Vestibular Diseases	Vestibular Diseases	CTD_human_DG	18776599		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vestibular Diseases	Vestibular disease	Pubtator	18776599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	BEFREE	19571817, 23179585, 29199612		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19571817, 23179585, 29199612		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	17593927, 21570215		★☆☆☆☆ Found in Text Mining only