GSTM1 (glutathione S-transferase mu 1)

Gene

• Entrez ID: 2944
• Gene name: Glutathione S-transferase mu 1
• Gene symbol: GSTM1
• Synonyms (NCBI Gene): GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2007311	hsa-miR-2467-3p	CLIP-seq
MIRT2007312	hsa-miR-3678-3p	CLIP-seq
MIRT2007313	hsa-miR-4267	CLIP-seq
MIRT2007314	hsa-miR-4731-5p	CLIP-seq
MIRT2388804	hsa-miR-4508	CLIP-seq
MIRT2543552	hsa-miR-1252	CLIP-seq
MIRT2543553	hsa-miR-1264	CLIP-seq
MIRT2543554	hsa-miR-1302	CLIP-seq
MIRT2543555	hsa-miR-130a	CLIP-seq
MIRT2543556	hsa-miR-130b	CLIP-seq
MIRT2543557	hsa-miR-1909	CLIP-seq
MIRT2543558	hsa-miR-2467-5p	CLIP-seq
MIRT2543559	hsa-miR-2861	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT2543560	hsa-miR-301a	CLIP-seq
MIRT2543561	hsa-miR-301b	CLIP-seq
MIRT2543562	hsa-miR-3119	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT2543563	hsa-miR-3132	CLIP-seq
MIRT2543564	hsa-miR-3155	CLIP-seq
MIRT2543565	hsa-miR-3155b	CLIP-seq
MIRT2543566	hsa-miR-3188	CLIP-seq
MIRT2543567	hsa-miR-3202	CLIP-seq
MIRT2543568	hsa-miR-3591-5p	CLIP-seq
MIRT2543569	hsa-miR-3666	CLIP-seq
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT2543570	hsa-miR-3974	CLIP-seq
MIRT2543571	hsa-miR-3975	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT2543572	hsa-miR-4295	CLIP-seq
MIRT2543573	hsa-miR-4298	CLIP-seq
MIRT2543574	hsa-miR-4473	CLIP-seq
MIRT2543575	hsa-miR-4476	CLIP-seq
MIRT2543576	hsa-miR-4512	CLIP-seq
MIRT2543577	hsa-miR-4533	CLIP-seq
MIRT2543578	hsa-miR-454	CLIP-seq
MIRT2543579	hsa-miR-4649-3p	CLIP-seq
MIRT2543580	hsa-miR-4671-3p	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT2543581	hsa-miR-4727-3p	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT2543582	hsa-miR-4747-5p	CLIP-seq
MIRT2543583	hsa-miR-484	CLIP-seq
MIRT2543584	hsa-miR-485-5p	CLIP-seq
MIRT2543585	hsa-miR-493	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2543586	hsa-miR-635	CLIP-seq
MIRT2682141	hsa-miR-1224-3p	CLIP-seq
MIRT2543552	hsa-miR-1252	CLIP-seq
MIRT2682142	hsa-miR-1260	CLIP-seq
MIRT2682143	hsa-miR-1260b	CLIP-seq
MIRT2543553	hsa-miR-1264	CLIP-seq
MIRT2682144	hsa-miR-1280	CLIP-seq
MIRT2543554	hsa-miR-1302	CLIP-seq
MIRT2543555	hsa-miR-130a	CLIP-seq
MIRT2543556	hsa-miR-130b	CLIP-seq
MIRT2682145	hsa-miR-151-5p	CLIP-seq
MIRT2682146	hsa-miR-151b	CLIP-seq
MIRT2682147	hsa-miR-1827	CLIP-seq
MIRT2543557	hsa-miR-1909	CLIP-seq
MIRT2543558	hsa-miR-2467-5p	CLIP-seq
MIRT2543559	hsa-miR-2861	CLIP-seq
MIRT1036559	hsa-miR-2909	CLIP-seq
MIRT2543560	hsa-miR-301a	CLIP-seq
MIRT2543561	hsa-miR-301b	CLIP-seq
MIRT2543562	hsa-miR-3119	CLIP-seq
MIRT1036560	hsa-miR-3126-5p	CLIP-seq
MIRT2543563	hsa-miR-3132	CLIP-seq
MIRT2543564	hsa-miR-3155	CLIP-seq
MIRT2543565	hsa-miR-3155b	CLIP-seq
MIRT2682148	hsa-miR-3176	CLIP-seq
MIRT2543566	hsa-miR-3188	CLIP-seq
MIRT2543567	hsa-miR-3202	CLIP-seq
MIRT2543568	hsa-miR-3591-5p	CLIP-seq
MIRT2682149	hsa-miR-3612	CLIP-seq
MIRT2682150	hsa-miR-3665	CLIP-seq
MIRT2543569	hsa-miR-3666	CLIP-seq
MIRT1036556	hsa-miR-3689a-3p	CLIP-seq
MIRT1036557	hsa-miR-3689c	CLIP-seq
MIRT2682151	hsa-miR-3922-3p	CLIP-seq
MIRT2682152	hsa-miR-3922-5p	CLIP-seq
MIRT2543570	hsa-miR-3974	CLIP-seq
MIRT2543571	hsa-miR-3975	CLIP-seq
MIRT1036561	hsa-miR-4278	CLIP-seq
MIRT2543572	hsa-miR-4295	CLIP-seq
MIRT2543573	hsa-miR-4298	CLIP-seq
MIRT2543574	hsa-miR-4473	CLIP-seq
MIRT2543575	hsa-miR-4476	CLIP-seq
MIRT2543576	hsa-miR-4512	CLIP-seq
MIRT2543577	hsa-miR-4533	CLIP-seq
MIRT2543578	hsa-miR-454	CLIP-seq
MIRT2543579	hsa-miR-4649-3p	CLIP-seq
MIRT2543580	hsa-miR-4671-3p	CLIP-seq
MIRT2682153	hsa-miR-4695-5p	CLIP-seq
MIRT1036562	hsa-miR-4709-3p	CLIP-seq
MIRT1036563	hsa-miR-4716-3p	CLIP-seq
MIRT1036564	hsa-miR-4723-5p	CLIP-seq
MIRT2543581	hsa-miR-4727-3p	CLIP-seq
MIRT1036558	hsa-miR-4728-5p	CLIP-seq
MIRT2007314	hsa-miR-4731-5p	CLIP-seq
MIRT2682154	hsa-miR-4736	CLIP-seq
MIRT2543582	hsa-miR-4747-5p	CLIP-seq
MIRT2543583	hsa-miR-484	CLIP-seq
MIRT2543584	hsa-miR-485-5p	CLIP-seq
MIRT2543585	hsa-miR-493	CLIP-seq
MIRT1036565	hsa-miR-629	CLIP-seq
MIRT2543586	hsa-miR-635	CLIP-seq
MIRT2682155	hsa-miR-650	CLIP-seq
MIRT2682156	hsa-miR-764	CLIP-seq
MIRT2682157	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Activation	14576818

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	8373352, 9084911
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	TAS	8403204
GO:0005737	Component	Cytoplasm	IDA	8373352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IDA	9084911
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	8373352
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018916	Process	Nitrobenzene metabolic process	IDA	8373352
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	8373352
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	8373352
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0070458	Process	Cellular detoxification of nitrogen compound	IDA	8373352
GO:1901687	Process	Glutathione derivative biosynthetic process	IDA	9084911

Other IDs

• MIM: 138350
• HGNC: 4632
• e!Ensembl: ENSG00000134184

Protein

• UniProt ID: P09488
• Protein name: Glutathione S-transferase Mu 1 (EC 2.5.1.18) (GST HB subunit 4) (GST class-mu 1) (GSTM1-1) (GSTM1a-1a) (GSTM1b-1b) (GTH4)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Particip
• PDB: 1GTU, 1XW6, 1XWK, 1YJ6, 2F3M, 7BEU, 8VOU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain
  PF14497	GST_C_3	105 → 201	Glutathione S-transferase, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver (at protein level). {ECO:0000269|PubMed:7822249}.
• Sequence:

  MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
  PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
  EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
  LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK

• Sequence length: 218

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGLE CLOSURE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHLORACNE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ATRESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GSTM1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC VENO-OCCLUSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR DEGENERATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PORPHYRIA CUTANEA TARDA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAYNAUD DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENILE CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THALASSEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	12485442, 19874347		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	15862746, 16493615, 17581325, 18505952, 23725116, 24022662, 24194954, 24716937, 24854448, 25799091		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10029576, 10673738, 10868688, 10940507, 10953966, 12439226, 14510941, 14991750, 15382273, 15862746, 17581325, 18444911, 19256768, 22215096, 22930568, 23444902, 23707957, 23725116, 25102096, 27299594, 30659796		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11230469		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	15131792, 27984487		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18035413, 21875282		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10493307, 10952100, 11470766, 11740339, 11751390, 11809532, 12781423, 14534704, 15375499, 16338071, 19669596, 22248273, 25036724, 26529288, 7581494, 7923570, 8313538, 9029171, 9809991		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11809532, 12824892, 14607333		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17064856		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	12682546, 8824506		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10521684, 11470766, 12163326, 12824892, 14607333, 1486868, 15375499, 22085405		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10817498		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18093316, 7614700		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10625170, 10919645, 11165755, 11773864, 16030123, 16365014, 20375710, 22161138, 7882312, 9718215		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	23946381		★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	26529288		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	21967547, 26937962		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10029576, 10673738, 10868688, 10953966, 14991750, 22215096, 22930568, 25102096, 27299594		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	12351375, 20731606		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22484853, 25379720		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19391035, 20977336, 21916526		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18952980, 22661588		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11325850		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16496253		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21212706, 21701824, 22410570, 23244519, 25897651		★☆☆☆☆ Found in Text Mining only
Age-related cortical cataract	Cortical cataract	BEFREE	22665971		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	17524385		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25542503	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	22381228, 22813660, 29072550		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	8959321		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	19635899		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11719393	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	16173971	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25880856, 27885941	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	23590899, 27885941		★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	12080991		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	18334963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26186891		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	11977425		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22661588		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	22661588	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22661588, 24637631		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	11719393, 16079101		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic Anemia	Aplastic anemia	LHGDN	16227674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	25880856	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11500195, 12355548, 12798451, 12859033, 22330623, 24407598, 28362975, 29658969		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	11920399	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11920399, 16887863, 21087494, 21445357, 28703442	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	17563610, 9055949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	10840461, 11470996, 11862323, 11927838, 12186820, 12969868, 15223862, 15300848, 15612961, 16162701, 16409207, 16456144, 16550944, 16870661, 16882827, 17497028, 17643058, 17651144, 18511640, 18988661, 19591959, 19860819, 19996333, 20032267, 20049212, 20073549, 20526719, 21051083, 21109554, 21183608, 21196426, 21320344, 21325943, 22040239, 22326267, 22484660, 23204253, 23307299, 23600494, 24559168, 25118837, 25328891, 27043549, 29557517, 31214241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12325261, 15148962, 15300848, 15612961, 15723126, 17497028, 17643058, 18988661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15223862, 17497028, 18988661, 19860819, 20526719, 21051083, 22228263, 24186968, 25328891, 31059917, 35186174	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	16870661, 18988661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	12241105, 7671227, 8824514, 9230293		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	15102663		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11500195, 12355548, 12798451, 12859033, 22330623, 24407598, 28362975, 29658969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	19822795		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	22363809, 28362975	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	30824761	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	35741737	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30824761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	16472391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	16472391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	16472391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	16472391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	11680579		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21087494		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	23026209, 23311983, 23877133		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	30732132		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21681823		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18061941		★☆☆☆☆ Found in Text Mining only
Balkan Nephropathy	Balkan Nephropathy	BEFREE	15365958, 15365959, 27568660		★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	BEFREE	9973204		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17064856, 17476458, 20056743		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	7634433		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	15309405, 16283344		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22766250		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19407363, 20843117, 21089003, 21133626, 21694442, 22692893		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	26288192	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	26691424, 27104679		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	27104679		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	36181129	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20674986, 28043918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20674986, 22925223		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10022251, 10783912, 10828664, 10840461, 10845567, 10859543, 10970445, 11131031, 11173863, 11297759, 11323185, 11757669, 11825664, 12117698, 12429337, 12500666, 12552997, 14643449, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16003747, 16005379, 16112301, 16918316, 17026750, 17290402, 17340208, 17381051, 17496311, 18304215, 18505952, 18544563, 18569590, 18632753, 18690546, 18979064, 19117770, 19303722, 19380028, 19443391, 19549811, 20514077, 20732908, 20942828, 21037224, 21079384, 21082260, 21286014, 21292509, 21558090, 21562205, 21586620, 21647780, 21709011, 21738036, 22154357, 22339266, 22686316, 22817656, 23054023, 23394311, 23886208, 24022663, 24075358, 24740636, 24914957, 25284638, 26374428, 26854433, 27568660, 27631264, 27911277, 28403014, 28696839, 28696895, 28696897, 29695243, 30419877, 30539835, 31009110, 31646988, 7620941, 8033143, 8200072, 8200080, 8320745, 8634658, 8752158, 8807665, 8824515, 8959320, 9010594, 9107426, 9544433, 9568791, 9679567, 9751255, 9921921		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15832776, 17026750, 17340208, 18304215, 18365755, 18569590, 19209780		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	18505952, 20972438		★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	16173971	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	26681006		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	20674986, 28043918		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	12241105, 15642394, 22502694, 23661361, 9230293		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	15642394		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23661361	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	18080216		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10064333, 10548311, 10564681, 10779639, 10862521, 10868690, 11045791, 11303592, 11408954, 11585745, 11700265, 11731429, 11773866, 11792413, 11810042, 11872636, 11934439, 12150456, 12175533, 12296511, 12430181, 12556960, 12611461, 12835615, 12860276, 12873994, 14562023, 14973092, 14973116, 15090724, 15113959, 15141140, 15280903, 15302996, 15342448, 15344211, 15538046, 15725614, 15784178, 15808397, 16049806, 16238106, 16758119, 17180579, 17624589, 17693660, 17696741, 18058229, 18425393, 18521819, 18542066, 18574688, 19228880, 19287154, 19287511, 19440493, 19760040, 19856098, 19921428, 19936916, 20568049, 20728566, 21129090, 21431478, 21557334, 21559761, 22126558, 22300440, 22564471, 23000097, 23227845, 23244102, 23376175, 26125851, 26345960, 26400343, 26407578, 26535619, 26572891, 26577857, 26681014, 27444273, 27785604, 28455582, 28747156, 29267651, 30032483, 30732156, 30803216, 30941643, 31450925, 7627950, 9232338, 9426059, 9539246, 9679567, 9726005, 9888479		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	11056682, 14562023, 17416769, 17624589, 17683074, 17696741, 18425393, 18542066, 19287511, 19469640, 20568049, 21557334, 22564471, 22782090, 23244102, 24535908, 25375048, 25809865, 26125851, 26535619, 27444273, 27964748, 28467815, 30032483, 31450925, 32856852, 36308374, 38019237, 40156399, 9888479	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	24613990	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	15928955, 8834254, 9187680		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	20674986, 24120392, 28043918		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	19338664, 22393996, 23275251, 23317262, 23679259		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17203516, 18596959, 26295053, 26434855, 34269240	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16582078, 9077484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	17505575	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8554981	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15633230, 20683151, 22994742, 29582627, 7892276, 8659516	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	11056682	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10022251, 10783912, 10828664, 10840461, 10845567, 10859543, 10970445, 11131031, 11173863, 11297759, 11323185, 11757669, 11825664, 12117698, 12429337, 12500666, 12552997, 14643449, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16003747, 16005379, 16112301, 16918316, 17026750, 17290402, 17340208, 17381051, 17496311, 18304215, 18505952, 18544563, 18569590, 18632753, 18979064, 19117770, 19303722, 19380028, 19443391, 19549811, 19801959, 20514077, 20732908, 20919828, 20942828, 21037224, 21079384, 21082260, 21286014, 21292509, 21558090, 21562205, 21586620, 21647780, 21709011, 21738036, 22154357, 22339266, 22686316, 22686319, 22817656, 23054023, 23394311, 23664103, 23886208, 24022663, 24075358, 24240585, 24740636, 24914957, 24919441, 25284638, 26374428, 26854433, 27568660, 27631264, 27911277, 28403014, 28696839, 28696895, 28696897, 29695243, 30419877, 30539835, 31009110, 31646988, 7620941, 8033143, 8200072, 8200080, 8320745, 8634658, 8752158, 8807665, 8824515, 8959320, 9010594, 9107426, 9544433, 9568791, 9679567, 9751255, 9921921		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	11477586, 12668919, 12748560, 14594555, 19252926, 22296360, 22900055, 22972496, 24643684, 28331336, 9456238		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10022250, 10209943, 10376794, 10454258, 10493307, 10521684, 10566550, 10571654, 10580025, 10597978, 10607731, 10607733, 10616169, 10744127, 10868696, 10901185, 10952100, 10996421, 11008920, 11037803, 11045782, 11062156, 11085692, 11137199, 11219770, 11406420, 11501853, 11588132, 11675150, 11740339, 11751442, 12019159, 12151353, 12175548, 12189190, 12376472, 12397651, 12771031, 12781423, 12814998, 12894585, 12925969, 14534704, 14553946, 14626895, 14628089, 14644336, 14666648, 1486868, 15069685, 15105047, 15138056, 15165083, 15184245, 15246186, 15363546, 15528218, 15640939, 15646021, 15661806, 15801482, 15953982, 16012082, 16099114, 16228113, 16257343, 16416283, 16614107, 16642467, 16788248, 16939958, 17016589, 17123660, 17307802, 17428572, 17428724, 17496311, 17565746, 17900751, 18082227, 18270371, 18415801, 18420756, 18463401, 18573508, 19009239, 19124497, 19394866, 19428374, 19567511, 19669596, 19838921, 19963114, 20049629, 20091863, 20156772, 20501762, 20638923, 20729793, 20854097, 21122939, 21791872, 22109568, 22154617, 22206016, 22392686, 22525558, 22888806, 22893352, 23000285, 23013535, 23090633, 23803127, 24222509, 24326830, 24460270, 24515656, 24682953, 24732639, 24815479, 24852519, 24938875, 25027082, 25033877, 25036724, 25040976, 25292056, 25388590, 25730077, 25797617, 26458582, 26529288, 27099270, 27461642, 28315511, 28427236, 28770368, 29076184, 29110844, 29412865, 29604112, 30123431, 30362324, 31446980, 7563171, 7581493, 7607565, 7728947, 7885376, 7923570, 7955090, 7974294, 8020145, 8103989, 8313538, 8330369, 8439946, 8547824, 8665871, 8781385, 8834254, 9029171, 9066737, 9162298, 9230269, 9230293, 9242469, 9242470, 9257159, 9276626, 9307183, 9434875, 9635872, 9679751, 9796632, 9829708, 9855008, 9894148, 9918133, 9921921		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22960333, 8956789	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	14504370, 18566013	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27500405	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25472599	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11511301, 21870186, 9231161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22169897, 25663492	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	23394311	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10383895, 10975609, 11044240, 11337940, 15459020, 17083362, 23184764, 7634433, 7905099, 8554981, 8616834, 8824510, 9077484, 9679566, 9950241		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10868693, 11159742, 11159743, 11328408, 20966642, 22960333, 23884605, 24532428, 25124586, 26803611, 27586145, 28365938, 8956789, 9751255, 9796976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34871528	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15088107, 17448506		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24423050, 33574979	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12879272, 16973168, 22330623		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25566970		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	11040079, 15194507, 16551760, 17514530, 22665971, 22876127, 24754249, 26208492, 27706600, 7781744, 8631631		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	16551760, 22665971, 22876127	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	LHGDN	17514530		★☆☆☆☆ Found in Text Mining only
Cataract posterior polar 1	Congenital cataract	Pubtator	22665971	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17873299		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22528457, 23590899, 24423050		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10489995, 12552594, 15004652, 15047208, 15138035, 15661231, 16360200, 16631467, 18177825, 19012698, 19640174, 21150818, 21520994, 22575983, 22631654, 24391774, 25773790, 26434855, 27461638, 29909733, 7917923		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	11330960, 18090121, 21868558, 7917923		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10489995, 10813720, 12552594, 15004652, 15047208, 15138035, 15661231, 16360200, 16631467, 18177825, 19640174, 21150818, 21520994, 22575983, 22631654, 24391774, 25773790, 26434855, 27461638, 29909733, 7917923		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10029576, 10673738, 10868688, 10953966, 12070010, 14991750, 15981231, 22215096, 22930568, 25102096, 27299594, 9057653		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	10868689		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	12969868, 16162701, 17643058, 19591959, 19860819, 20032267, 23368529, 25328891		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18952980, 22661588		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	31755784		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	25798860		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15492856, 18067039, 24423050, 27498857, 31340563		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20954980, 23220723, 24216264, 31555322		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	15928955		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12010828, 18061941		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12010828		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	14662420		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10639528, 14534704, 15038404, 15218992, 16919984, 16977512, 17439673, 18461673, 19017460, 19664521, 19933216, 20402821, 20495862, 20842440, 21309732, 21734345, 22160572, 29704242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	36833382	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15120366, 15215328, 16316639, 26163595, 29921322		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	28284893		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	12631536		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	18952980, 21734345	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21301992		★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10680724, 10868693, 10925368, 11133820, 12507929, 14523342, 14601045, 15496536, 16596290, 19443391, 20688591, 23314736, 30106268, 7614702, 8403204, 8959321, 9003527, 9829708, 9865425, 9950235		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12195642		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12210502		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32539715	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10207630, 10424787, 10445390, 10625170, 10680724, 10769717, 10901185, 11410321, 11487538, 12074508, 12419832, 12507929, 12530094, 12944179, 14523342, 15496536, 15637738, 15671210, 15736440, 15770723, 15932063, 16328000, 16395669, 16829689, 16865249, 16886896, 17603900, 18093316, 18159984, 18473390, 19124514, 19580344, 19933708, 19960570, 20017670, 20123161, 20207535, 20688591, 20878130, 20937634, 21385088, 22126490, 22228187, 22234881, 22237425, 23773486, 23886179, 23946381, 24014086, 24197978, 24254297, 24467372, 24842074, 25249451, 25408579, 26219826, 26831664, 26909940, 29516983, 30106268, 30694518, 7614702, 8625505, 9829708		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	20878130		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10901185, 18093316, 18473390, 18630481, 19443391, 20937634, 22126490, 23790786, 23886179, 25249451, 25408579, 26406947, 26909940, 30106268, 35674599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11809532, 31740522, 8824506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12072547, 12074508, 12944179, 18159984, 18630481		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	20878130		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20937634, 30356976, 30694518	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31740522	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	BEFREE	12736537		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10207633, 10633178, 10708971, 10984680, 11170238, 11909761, 12355548, 15093278, 15470755, 16949064, 17019047, 19270789, 19481674, 19778234, 21193517, 21360194, 21843791, 24290889, 25395496, 26207596, 28770368, 8665871, 8901885, 9093388, 9729241		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	24114827, 24903797		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	25472599		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17182005		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10794492, 18566013, 19424176, 20083259, 21458313, 22054067, 22880812, 22994718, 23717494, 24337975, 26656529, 27185341, 28284893, 29884137		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12519635, 15088107, 17408703, 18583868, 19055448, 19419718, 19662515, 19823950, 20354063, 21389716, 21848428, 24525147, 25183432, 27215231, 30039864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	12519635, 15088107, 16620396, 17408703, 18583868, 19055448, 19102712, 19662515, 19823950, 20093049, 20354063, 21352813, 21389716, 21499713, 21848428, 24525147, 25183432, 27182613, 27215231, 30039864		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12519635, 12811412, 17408703, 18583868, 19102712		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16620396, 18583868, 28362975	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10729397, 12519635, 14644396, 15088107, 17408703, 18583868, 19055448, 19662515, 19823950, 20354063, 21389716, 21848428, 21890078, 24525147, 25183432, 26456689, 27215231, 29480151, 30039864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cortical cataract	Cortical cataract	BEFREE	10892871		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17565649, 21243434, 31689810		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11352862, 17072629, 21461548, 23860951, 27540835, 30883948		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10195071, 12297838, 15115915, 19097986, 22407040, 23758905, 24593045, 8834254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	10195071, 20140303, 23758905, 24593045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	28069791		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22686321		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	1337448, 18325667, 18420756, 22661588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	18420756, 22661588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	22661588	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	26580648, 30650146	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	14714091		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	20674822, 21176116, 26580648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16353154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	16413497, 17979505, 24203463, 26125818, 29452132		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	26823865, 27323114	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16413497, 16927413, 17979505, 22086798, 22732554, 23296061, 23296494, 24203463, 26125818, 29452132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16927413		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	20954980, 22058002, 22086798, 22732554, 36676788	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16390810, 19752172, 24053064, 27908841	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22058002, 22377702, 24098457	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36834424	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16390810, 19752172, 23296494, 27908841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16413497, 17979505, 19102712, 20739761, 21352813, 22058002, 22330623, 22377702, 22652274, 22858312, 23014993, 23296494, 24008019, 24098457, 24203463, 24685594, 24907704, 26435566, 28548478, 29111615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	22652274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10901185, 19752172, 26252359, 29981844		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	16523188, 26435566		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	19752172, 22377702		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	19752172	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	22377702	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22484853, 23391141, 25379720, 28039708		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	12873455		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	21508403		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	11352862		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	15916660		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20674822, 21176116, 26580648		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	21734345	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30783009		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	14658041, 8923609		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20381444, 21558497		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10381818, 11159742, 11675474, 11730751, 12620480, 12875700, 15299090, 15531593, 15861041, 15878920, 16291859, 17513317, 19535834, 20147336, 20504102, 21958689, 22017422, 23979901, 25208225, 25549292, 26350109, 26370772, 27525656, 30989213, 31821471, 8834254, 9358003		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11730751, 12620480, 19535834, 20504102, 25549292, 27323100, 34384077, 36013572	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15059587		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12499585, 24970787		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	12499585, 18644106	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22960333, 27586145, 8956789, 9796976		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	20740495, 23828841		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10840162, 11833070, 12406553, 15052670, 16338071, 17203516, 17916905, 19427967, 20391126, 20409775, 20661821, 23625656, 23749488, 25432134, 26782562, 26855551, 29215312, 31423187, 9139841, 9307183, 9973204		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10840162, 11833070, 12406553, 15052670, 16338071, 17203516, 17916905, 19427967, 20391126, 20409775, 20661821, 23749488, 25432134, 26782562, 26855551, 29215312, 31423187, 9139841, 9973204		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15052670		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15968714, 17203516, 23749488, 26782562	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25432134, 26004606	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19782926, 24788870		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25357227, 32188413, 34193266, 35132887	Associate	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	16020292		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	16496253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	19917083, 9861231		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16173971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	26937962		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	18829006, 20147336, 24324590		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	17531965, 20544687, 24136740, 31755784		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	16760134, 17531965		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26925680	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	12767525, 12940438, 8824506		★☆☆☆☆ Found in Text Mining only
Gastric Cardia Carcinoma	Gastric Cardia Carcinoma	BEFREE	15801491		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	21508403		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	15112335	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis, Atrophic	Gastritis	BEFREE	21508403		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	19960570	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	11040079, 12798451, 12873455, 15864623, 16973661, 18334963, 20547950, 21151336, 21701824, 23342067, 25366778, 28710033, 30225227		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	16973661, 18334963, 25366778	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	18334963, 25725180	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16973661	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	18334963, 21738397, 23079819, 25366778	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	16973661		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	28710033		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	11040079, 12798451, 15864623, 16973661, 21738397, 23079819, 23342067, 23747403, 23827458, 25366778, 27381611, 30225227		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34732244	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9230293		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9230293		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17372252, 23079710, 23765968		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26103006	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	20672371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	17980001		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	11740339		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	14688020, 14693745, 15195058, 16302194, 16721740, 17005168, 18074677, 18425322, 18590468, 20491576, 20846153, 21133595, 21438663, 21545198, 23661016, 23886141, 24452716, 25015263, 25724184, 9486585, 9659241		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	18590468		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20676536, 21133595, 21545198, 36037119	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	32435918	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	18162130	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26456689	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30095041, 34193266	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	15916660		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	29204680	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30537151, 31555969		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34499222	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	15934438, 29204680		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	20672371		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33574979	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36952646	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	23287989, 26729828	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic venoocclusive disease with immunodeficiency	Hepatic veno occlusive disease with immunodeficiency	Pubtator	15142875	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	39863504	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	7892276	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	8659516	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	27964748	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	17087981, 17119063		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15338373		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	20661602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	15368334	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19391035, 20977336, 21916526		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	21997310		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia Neonatal	Hyperbilirubinemia	Pubtator	24186968, 28069791	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23107763		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22108414, 25357227, 32188413, 35132887	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25880856	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17182005, 18300949, 18551009, 18840420, 19279659, 19531963, 20073549, 20517701, 20732908, 21053180, 21728793, 22108414, 24407598, 24685594, 24788870, 25357227, 25742618, 25880856, 26940095, 30308595, 30420646		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17182005, 18300949		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19419718	Associate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	15579657, 21300689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29480151		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29795558		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	34384077, 34871528	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	22903474, 25532576, 33786731, 34806654	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17565649, 21243434, 23787247, 26604430, 30987408, 31689810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17565649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30987408	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24535908		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	LHGDN	18477036		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	26288192	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31694285		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20517701		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18328165		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	12485442, 19874347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratosis	Keratosis	LHGDN	12485442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratosis	Keratosis	Pubtator	12485442	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Calculi	Kidney stone	BEFREE	31445152		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10901185, 23220723, 26940095		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18067039, 24423050, 26940095, 27498857, 33574979	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15492856, 18067039, 24423050, 27498857, 31340563		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	18067039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	14594555		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	14594555	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15334395, 15914211, 16938565		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	18829006, 24324590	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23077626		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23077626	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10383893, 16284498, 17496311, 17581325, 18414197, 23444902, 26578531, 30659796		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	LHGDN	12827651, 14607752, 18414197, 18610829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	14694614, 18505952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12351375, 12827651, 16493615, 23725116, 23886197, 24854448, 26960454, 36316809	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25799091	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	21875282	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10815689, 11230469, 11488937, 11840286, 15102670, 15194533, 17118447, 18035413, 18287869, 18414197, 18760837, 19811334, 22924777, 22930568, 24854448, 24994605, 25145382, 25379720		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12351375, 17118447, 18207572, 18760837		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19555437, 20530282, 23812950		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	10334189, 14735473, 19634112, 21741876		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	10334189, 10571654, 16519766, 18507060, 19634112, 21741876, 27152506		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	LHGDN	16519766		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10762000, 10793329, 10889918, 11246217, 11564581, 12016153, 14662415, 15206494, 16721740, 16830058, 17418613, 17461521, 18838881, 19160101, 19469619, 19729828, 19953622, 21436184, 21545219, 21741876, 23265943, 23444898, 23801151, 23900674, 24102947, 24528041, 25595865, 25735346, 26166128, 26925672, 29037125, 30539845, 9332761, 9367063		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10051470, 10192309, 10408872, 11227922, 11440964, 11470760, 14519756, 15633230, 15688397, 15734960, 16132793, 16314088, 17870518, 18065725, 18816171, 19643819, 20561699, 20672314, 20683151, 21912475, 22994742, 23053942, 23185284, 23390017, 23437305, 23959468, 24399650, 24852428, 24998552, 25379720, 26163595, 29928420, 30976200, 31605953, 31731000, 7557094, 7892276, 8635154, 8659516, 9255556, 9288607		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	11859714, 15633230, 18816171		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	7892276		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15120366, 15215328, 16316639, 26163595, 29921322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	8491405	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19157724, 19428381, 20171022, 8834254		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	26937962	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	29582627	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24465778, 29582627	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	21214675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	15115915, 19796798, 22683820, 8961976, 9187680		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	21734345, 7974294	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	9055949		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10901185, 16788248, 18281920, 19174490, 19394866, 19567511, 20156772, 20501762, 21122939, 21206385, 22392686, 22888806, 23803127, 24222509, 24460270, 24815479, 25040976, 25292056, 27090234, 30362324, 31554367, 35381771, 7974294, 9888479	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	11844594, 11939169, 12151353, 12189190, 12376472, 12814998, 14534704, 14553946, 14628089, 14666648, 15008663, 16009381, 16012082, 16228113, 17565746, 17900751, 18415801, 18463401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	17114358, 17311802, 22072123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	24852519	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	8020145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17195228	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11477481, 12563680, 17195228, 20226777, 22217397, 25628002, 27755947		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphedema	Lymphedema	Pubtator	36181129	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11406608, 22734843		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	12091121, 18061941		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12091121, 12139735, 18061941, 21681823		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12091121, 17454600		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	12091121, 18061941, 21681823		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31358475		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	22410570	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macular Degeneration	Macular degeneration	Pubtator	25897651	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	23765968		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	14688020, 14693745, 15195058, 16302194, 16721740, 17005168, 18074677, 18425322, 18590468, 20491576, 20846153, 21133595, 21438663, 21545198, 23661016, 23886141, 24452716, 25015263, 25724184, 9486585, 9659241		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	16697254, 21765044, 7606714, 8961976		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	16697254		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10064333, 10548311, 10564681, 10779639, 10862521, 10868690, 11045791, 11056682, 11303592, 11408954, 11585745, 11700265, 11731429, 11773866, 11810042, 11872636, 11934439, 12150456, 12175533, 12296511, 12430181, 12556960, 12611461, 12835615, 12860276, 12873994, 14973092, 14973116, 15090724, 15113959, 15141140, 15280903, 15302996, 15342448, 15344211, 15538046, 15725614, 15784178, 15808397, 16049806, 16238106, 16758119, 17180579, 17624589, 17693660, 17696741, 18058229, 18425393, 18521819, 18542066, 18574688, 19228880, 19287154, 19287511, 19440493, 19760040, 19856098, 19921428, 19936916, 20568049, 20728566, 21129090, 21431478, 21557334, 21559761, 22126558, 22300440, 22564471, 23000097, 23227845, 23244102, 23376175, 26125851, 26345960, 26400343, 26407578, 26535619, 26572891, 26577857, 26681014, 27444273, 27785604, 28455582, 28747156, 29267651, 30032483, 30732156, 30803216, 30941643, 31450925, 7627950, 9232338, 9426059, 9539246, 9679567, 9726005, 9888479		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20381444, 21558497		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10840162, 11833070, 12406553, 15052670, 16338071, 17203516, 17916905, 19427967, 20391126, 20409775, 20661821, 23275251, 23749488, 25432134, 26782562, 26855551, 29215312, 31423187, 9139841, 9973204		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	16760134, 17531965, 20544687, 24136740, 26925680, 31755784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19960570, 21385088		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17479278, 17617661, 28403014, 9285043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	10067818, 11097350, 11477586, 12668919, 12748560, 14594555, 19252926, 22296360, 22900055, 22972496, 24643684, 28331336, 9066737, 9456238		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20683151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	21214675		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10022250, 10209943, 10376794, 10454258, 10493307, 10521684, 10566550, 10571654, 10580025, 10597978, 10607731, 10607733, 10616169, 10744127, 10868696, 10901185, 10952100, 10996421, 11008920, 11037803, 11045782, 11062156, 11085692, 11137199, 11219770, 11470766, 11501853, 11588132, 11675150, 11740339, 11751442, 12019159, 12151353, 12175548, 12189190, 12376472, 12397651, 12771031, 12781423, 12814998, 12894585, 12925969, 14534704, 14553946, 14626895, 14628089, 14644336, 14666648, 1486868, 15069685, 15105047, 15138056, 15165083, 15184245, 15246186, 15363546, 15528218, 15640939, 15646021, 15661806, 15801482, 15953982, 16012082, 16099114, 16228113, 16257343, 16416283, 16614107, 16642467, 16788248, 16939958, 17016589, 17123660, 17307802, 17428572, 17428724, 17496311, 17565746, 17900751, 18082227, 18270371, 18415801, 18420756, 18463401, 18573508, 19009239, 19124497, 19394866, 19428374, 19567511, 19669596, 19838921, 19963114, 20049629, 20091863, 20156772, 20501762, 20638923, 20729793, 20854097, 21122939, 21791872, 22109568, 22154617, 22206016, 22392686, 22525558, 22888806, 22893352, 23000285, 23013535, 23090633, 23803127, 24222509, 24326830, 24460270, 24515656, 24682953, 24732639, 24815479, 24852519, 24938875, 25027082, 25033877, 25036724, 25040976, 25292056, 25388590, 25730077, 25797617, 26458582, 26529288, 27099270, 27461642, 28315511, 28427236, 28770368, 29076184, 29110844, 29412865, 29604112, 30123431, 30362324, 31446980, 7563171, 7581493, 7581494, 7586131, 7607565, 7728947, 7885376, 7923570, 7955090, 8020145, 8103989, 8313538, 8330369, 8439946, 8547824, 8665871, 8781385, 8834254, 9029171, 9066737, 9162298, 9230269, 9230293, 9242469, 9242470, 9257159, 9276626, 9434875, 9635872, 9679751, 9796632, 9829708, 9855008, 9894148, 9918133, 9921921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	17114358, 17311802, 22072123		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10521794, 10762000, 10793329, 10889918, 11246217, 11564581, 12016153, 12657030, 14662415, 15206494, 16721740, 16830058, 17418613, 17461521, 18838881, 19160101, 19469619, 19718946, 19729828, 19953622, 21436184, 21545219, 21741876, 23265943, 23444898, 23801151, 23886141, 23900674, 24102947, 24528041, 25595865, 25735346, 26166128, 26925672, 29037125, 30539845, 9332761, 9367063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	19338664, 22393996, 23275251, 23317262, 23679259		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	10077151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10868693, 11159742, 11159743, 11328408, 20966642, 23884605, 24532428, 25124586, 25450282, 26803611, 28365938, 9751255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10817498, 23184765, 24528063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	18496222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10207629, 10643942, 11142418, 11275366, 11307147, 11434510, 11552710, 12663557, 12926131, 12949934, 14968442, 15381379, 15623468, 15638917, 15756908, 16018936, 16173036, 16235991, 16466991, 16614120, 16625286, 16720291, 16921513, 17059341, 17572208, 18154451, 18304461, 19143011, 19265530, 19568698, 20056632, 20599479, 20842440, 21089003, 21243008, 21694442, 21705483, 22564066, 22692893, 23071687, 23189206, 23534760, 23817691, 23888321, 23977100, 24086370, 25198353, 25773803, 26416453, 26614779, 27268642, 30595465, 9861231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	11275366, 18304461, 22564066		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20802377, 21967523, 23184764, 7905099		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10667466, 11562107, 11692073, 12406553, 12767525, 1427788, 14696128, 15112335, 15473001, 15596296, 15688399, 15929164, 16270381, 16837478, 18365908, 18398695, 18505952, 18779738, 19763824, 19960570, 20377137, 20854097, 21167396, 21385088, 21474334, 21553222, 21839153, 22471491, 22799358, 22952149, 22994755, 23167410, 23979980, 24244742, 24318990, 24948179, 27062139, 28198496, 8608558		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	9110358		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12433731, 15120911, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10022251, 10783912, 10828664, 10840461, 10845567, 10859543, 10970445, 11131031, 11173863, 11297759, 11323185, 11757669, 11825664, 12117698, 12429337, 12500666, 12505352, 12552997, 14643449, 15057507, 15122594, 15219943, 15588859, 15667866, 15694665, 15832776, 16003747, 16005379, 16112301, 16918316, 17026750, 17290402, 17340208, 17381051, 17496311, 18304215, 18505952, 18544563, 18569590, 18632753, 18979064, 19117770, 19303722, 19380028, 19443391, 19549811, 19801959, 20514077, 20732908, 20919828, 20942828, 21037224, 21079384, 21082260, 21286014, 21292509, 21558090, 21562205, 21586620, 21647780, 21709011, 21738036, 22154357, 22339266, 22686316, 22686319, 22817656, 23054023, 23394311, 23886208, 24022663, 24075358, 24240585, 24740636, 24914957, 24919441, 25284638, 26374428, 26645279, 26854433, 27404495, 27568660, 27631264, 27911277, 28403014, 28696839, 28696895, 28696897, 29695243, 30419877, 30539835, 31009110, 31646988, 7620941, 8033143, 8200072, 8200080, 8320745, 8634658, 8752158, 8807665, 8824515, 8959320, 9010594, 9107426, 9544433, 9568791, 9679567, 9751255, 9888479, 9921921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	18505952, 20972438		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10022251, 10397466, 10580025, 10621833, 10633178, 10667460, 10667466, 10673738, 10862521, 10868687, 10868689, 10889918, 10971208, 10996421, 11056682, 11075868, 11131031, 11137199, 11165755, 11230469, 11259393, 11297759, 11406420, 11408349, 11507974, 11934439, 12110344, 12140136, 12419833, 12430181, 12435115, 12552971, 12579293, 12747973, 12750240, 12798451, 12811412, 1427788, 14523342, 14594555, 14656945, 1486868, 14973116, 15122594, 15165083, 15195058, 15381379, 15471894, 15548945, 15688399, 15801491, 15808397, 15832776, 15968714, 16173036, 16235985, 16338071, 16621679, 16638627, 16830058, 1684153, 16911024, 16918316, 17010218, 17059334, 17087981, 17119046, 17213017, 17365577, 17381051, 17624589, 17707637, 17900751, 18035379, 18496222, 18569590, 18771857, 19252342, 19270789, 19443391, 20073549, 20083259, 20375710, 20514077, 20672314, 20688591, 21037224, 21089003, 21435086, 21558497, 21969307, 22692893, 22782580, 23275251, 23376175, 23394311, 23749488, 23810248, 23886141, 23994684, 24250808, 24452716, 24519899, 24682953, 24913811, 25399842, 25472599, 25640380, 26535619, 27525908, 28340461, 28455582, 29111561, 29285301, 29412865, 29516983, 29928420, 30499426, 31605953, 7640212, 7697828, 7882312, 8033143, 8625505, 8807665, 8824506, 8959321, 9055949, 9066737, 9214613, 9230293, 9257159, 9298582, 9307183, 9635872, 9649243, 9659241, 9679567, 9696930, 9723026, 9888479, 9921921		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	9110358		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10489995, 12552594, 15004652, 15047208, 15138035, 15661231, 16360200, 18177825, 19640174, 21150818, 21520994, 22575983, 22631654, 24391774, 25773790, 26434855, 27461638, 29909733, 7917923		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10680724, 10868693, 10925368, 11133820, 12507929, 14523342, 14601045, 15496536, 16596290, 19443391, 20688591, 23314736, 30106268, 7614702, 8403204, 8959321, 9003527, 9829708, 9865425, 9950235		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11872636, 12150456, 12296511, 12556960, 12835615, 12860276, 15344211, 16758119, 17624589, 17693660, 17696741, 18080216, 18425393, 18521819		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27964748		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18952980, 22661588		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18952980, 22661588	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11352862, 17072629, 17342328, 19161404, 19484507, 21461548, 21563941, 22251241, 23860951, 25588060, 27540835, 30883948, 7634433, 7640212, 7905099		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19161404, 21461548, 7640212	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	21461548	Associate	★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	29164594		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	22502694, 7671227		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	1337448, 18325667, 18420756, 22661588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	18420756, 22661588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Disorders, Severe	Mental Disorders	BEFREE	27114251		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	17290392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	17290392		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29452132		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	10759887		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15595630		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16052406		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21694442	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	25445355		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10215103		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22660220, 28182092	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	12016153, 18838881, 19160101		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17461521, 19729828, 21545219, 22660220, 23681307, 25735346, 29037125, 30539845, 34269240, 35390586, 35751315	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15339690		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	20074657, 28182092	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17653713, 18285692		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17437619, 23932298, 26150166, 28432518, 29055472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17437619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10616169, 11488937, 15595630, 18493876, 19816935, 23684483, 8569364, 9723026		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	14752874		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23684483	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15901999, 16235982, 17420047, 18224491, 19860557, 21969307, 22502716, 22576927, 24659449, 24671854, 24913811, 25188725, 27454607, 30995900, 31111691		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10744635, 17823442, 22858312, 23275234		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12519635		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21562205		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	16550944, 19701760		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10385146, 16235985, 18628429, 18712965, 19338664, 22393996, 23275251, 23317262, 23679259, 28331336, 28881764, 28952035		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16235985, 18628429, 18712965, 19448408	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	22393996	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10383893, 10424787, 10607733, 10621833, 10828664, 10965818, 10996421, 11056682, 11328408, 11408349, 11792413, 12019159, 12195642, 12241105, 12552594, 12872524, 14504203, 14523342, 15382272, 15499621, 15542115, 15840612, 16328000, 16427734, 16614120, 17342328, 17384900, 18365908, 18443805, 18507050, 19303722, 19358278, 19748847, 20060357, 20942828, 21545198, 21629772, 21709011, 22126490, 23802802, 26577857, 26645279, 26782376, 27444273, 27964748, 28455582, 7614700, 7614702, 8020145, 8330369, 8403204, 8616834, 8824510, 9230293, 9544433, 9726005, 9751255, 9834266		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31445152		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	18594869		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17700360		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22381228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy	Neuropathy	BEFREE	19786980		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	19555437, 20530282, 23812950		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	20530282	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	23204253, 25118837		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18492019, 22011249, 23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11740339, 11751390, 15038404, 15640939, 16195240, 19362955, 20638923, 20704749, 24729086, 25472599, 26722539, 27090234, 27173276, 27525853, 28572675, 30341887, 8959680		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23643483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	26937962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonarteritic anterior ischemic optic neuropathy (NAION)	Nonarteritic Anterior Ischemic Optic Neuropathy	BEFREE	19286687		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16020798, 19057702, 19884647		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16020798, 19057702	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	15102663		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	23026209, 23311983, 23324581, 23877133		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	20357201, 27381611		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	19286687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral cleft	Oral cleft	BEFREE	11471167		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	18573513, 21358205, 22752755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	10077151		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	22686321		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22048269		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22048269, 35602340	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	14973099, 22471480, 22938445, 27525908, 27721257		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22471480	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34384077	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10868693, 11159742, 11159743, 11328408, 20966642, 23884605, 24532428, 25124586, 25450282, 26803611, 28365938, 9751255		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12851839, 18768514		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11328408, 18768514	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10817498, 23184765, 24528063		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	9696930		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22301281	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	15215328, 9696930		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15215328		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12794689, 25378345		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	16173971		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18591888, 18601742, 24535271		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10215103, 10720475, 10821441, 11688992, 12524158, 14732367, 15061826, 15288444, 15834859, 17250723, 17403576, 17449559, 20461808, 23045187, 23982010, 24382428, 25868597, 27078701, 27216438, 31559607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	11688992, 17403576		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17194543, 17449559, 23982010, 32359946	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	17449559		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	10720475, 15061826		★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	15579657, 21300689		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	17069592, 17476458		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	18365908		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15491310, 17524385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	LHGDN	15491310, 17524385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	18952980, 36939926	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	16484137		★☆☆☆☆ Found in Text Mining only
Pharyngeal Neoplasms	Pharyngeal Neoplasms	LHGDN	18496222		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30321868	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	20847076	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15333250		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	29952411, 33124502	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	22018952		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	16365014, 30617052		★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	20957336		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria cutanea tarda	Pubtator	20957336	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	14607752		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10940507, 19256768, 23444902, 23707957, 30659796		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	18334963		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	8491405		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	10534244		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	8472315		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	12926131		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10207629, 11131031, 11142418, 11275366, 11307147, 11434510, 11552710, 12663557, 12926131, 12949934, 14968442, 15381379, 15623468, 15638917, 15756908, 16018936, 16173036, 16235991, 16466991, 16614120, 16625286, 16720291, 16921513, 17059341, 17572208, 18154451, 18304461, 19143011, 19265530, 19568698, 20056632, 20599479, 20842440, 21089003, 21243008, 21694442, 21705483, 22564066, 22692893, 23071687, 23189206, 23534760, 23817691, 23888321, 23977100, 24086370, 25198353, 25773803, 26416453, 26614779, 27268642, 30595465, 9861231		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	19407363, 20843117, 21089003, 21133626, 21694442	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	11275366, 18304461, 22564066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12949934, 15472409, 16173036, 16625286, 17572208, 18304461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15472409, 15899813, 16625286, 17059341, 19568698, 21089003, 21694442, 22564066, 25198353, 30362312, 35293017	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21705483	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	12713578	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21967523, 26535568, 27613512, 29067933, 31774007		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	27114251		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	15273656, 20596254, 20700368, 26125818		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15218992, 19860819, 21309732, 21513434, 21734345, 24506742, 27421065, 28949773, 28951769, 34707353, 36698131	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18461673	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24809844	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	20495862, 21734345, 9257159		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud Disease	CTD_human_DG	16977343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	16977343		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	CTD_human_DG	16977343		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	14504199, 15051825, 15496536, 20688591, 22686318, 26406947		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	15932063		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28718679		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17479278, 17617661, 28403014		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10794492, 14504370, 18566013, 19424176, 20083259, 21458313, 22054067, 22880812, 22994718, 23717494, 24337975, 26656529, 27185341, 28284893, 29884137, 9285043		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21651749		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	21651749		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	22377702		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21038299		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10364914, 11920399, 12879272, 15940757, 16870093, 16887863, 19473562, 20401725, 21087494, 21445357, 23053970, 23537991, 28703442, 28718679, 30873943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15940757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	BEFREE	27758991		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	18566013, 26656529		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11181039, 15318028, 19528963, 21093063, 23107768, 26046920, 26175060, 26295386, 27580934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19528963, 21093063, 22874804, 23107768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	28689274		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	10815689		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	12072547, 23287989		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	12499585	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30696891		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10616008, 24574234	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	17083362		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16353154, 16580705, 17284320		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	7905099		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	8554981	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15184245, 25036724, 7581494, 7923570		★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	23287989, 26729828		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	10779639, 14683420, 16835078, 20563767		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10385146, 10435155, 10489995, 10498401, 10506106, 10607733, 10793329, 11511301, 11740339, 11751390, 12175548, 14662415, 15668931, 15914211, 16416283, 17083362, 17221058, 18415801, 20060357, 21870186, 22072123, 22248273, 23184764, 25036724, 25663492, 7905099, 8001244, 8020145, 8330369, 8795591, 9029171, 9139841, 9231161, 9525287, 9635872, 9679751, 9809991		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12748560, 15526353, 16091114, 17221058, 17461521		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	22072123		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10868687, 12419833, 15801491, 15968714, 17203516, 17916905, 20409775, 20540773, 25432134, 9139841		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17461521, 19401526, 19442564, 21870186, 22660220, 23681307, 27723629, 31244319, 9659241	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35390586	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	12397651, 15375499, 16416283, 17016589, 18082227, 18463401, 21623257, 22072123, 25379720, 8319207, 8330369		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	12657030		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10371337, 10698480, 11447041, 14688020, 14724908, 16302194, 16618661, 17005168, 17119046, 17221058, 17653748, 18035380, 19334053, 19442564, 19639480, 20568895, 21957883, 23077643, 24519899, 25167831, 25724184, 9486585, 9659241		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	15968714		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10667466, 11562107, 11692073, 12172927, 12406553, 12767525, 1427788, 14696128, 15112335, 15473001, 15596296, 15688399, 15929164, 16270381, 16837478, 18365908, 18398695, 18505952, 18779738, 19763824, 19960570, 20377137, 20878561, 21167396, 21385088, 21474334, 21553222, 21839153, 22471491, 22799358, 22952149, 22994755, 23167410, 23979980, 24244742, 24318990, 24948179, 27062139, 28198496, 8608558		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28182092	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14696128, 15473001, 16334806, 16886896, 18365908		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15856451, 16270381, 19610060, 20878561, 22799358, 30726307, 36109518	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	18365908, 20878561		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22471491	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22994755	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24423050	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11477481, 15135176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	18199464, 19424176, 22154357, 23394311		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	21615938, 26244436		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	19741569		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	LHGDN	18162130		★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	28837637		★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	26691424		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18601742	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12433731, 12740153, 15120911, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	21086258		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	21086258	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12433731, 15120911, 18094897, 18591888, 18601742, 22765906		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18591888, 19169061		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15368334	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	21086258		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	28689274		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	22154357, 8320745		★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	CTD_human_DG	16703596		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17565649, 20459366, 21234761, 21243434, 21301992, 31689810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	28069791		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	16135950		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	18094897	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10783912, 15832776, 17026750, 17496311, 19692168, 21286014, 22817656, 23284801, 23394311, 23886208, 24040330, 24240585, 24914957, 24919441, 26374428, 26854433, 27568660, 28348449, 30539835, 31646988, 34452561	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17381051, 18544563, 20732908	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	26158735	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23159782		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	16433794		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20130515	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25281494, 26571237, 28361858	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	18829006, 20147336, 24324590, 26785830		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	11870126, 21488930, 26782535		★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	22766250		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	30095041	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	17568619, 19571817, 22681588, 24295891, 29641697		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	19571817, 29641697	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	17568619, 19571817, 22681588, 24295891, 29641697		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	15471894, 30042310		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	15459223, 30883948		★☆☆☆☆ Found in Text Mining only