GRPR (gastrin releasing peptide receptor)

Gene

• Entrez ID: 2925
• Gene name: Gastrin releasing peptide receptor
• Gene symbol: GRPR
• Synonyms (NCBI Gene): BB2, BB2R, BRS2
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050741	hsa-miR-17-3p	CLASH	23622248
MIRT1035462	hsa-miR-4421	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2239524	hsa-miR-129-5p	CLIP-seq
MIRT2239525	hsa-miR-1537	CLIP-seq
MIRT2239526	hsa-miR-3160-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239527	hsa-miR-4719	CLIP-seq
MIRT2239528	hsa-miR-513b	CLIP-seq
MIRT2239529	hsa-miR-520g	CLIP-seq
MIRT2239530	hsa-miR-520h	CLIP-seq
MIRT2239531	hsa-miR-548a-5p	CLIP-seq
MIRT2239532	hsa-miR-548aa	CLIP-seq
MIRT2239533	hsa-miR-548ab	CLIP-seq
MIRT2239534	hsa-miR-548ak	CLIP-seq
MIRT2239535	hsa-miR-548b-5p	CLIP-seq
MIRT2239536	hsa-miR-548c-5p	CLIP-seq
MIRT2239537	hsa-miR-548d-5p	CLIP-seq
MIRT2239538	hsa-miR-548h	CLIP-seq
MIRT2239539	hsa-miR-548i	CLIP-seq
MIRT2239540	hsa-miR-548j	CLIP-seq
MIRT2239541	hsa-miR-548w	CLIP-seq
MIRT2239542	hsa-miR-548y	CLIP-seq
MIRT2239543	hsa-miR-559	CLIP-seq
MIRT2239544	hsa-miR-607	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2450818	hsa-miR-3664-3p	CLIP-seq
MIRT2450819	hsa-miR-4433	CLIP-seq
MIRT2450820	hsa-miR-4459	CLIP-seq
MIRT2450821	hsa-miR-4493	CLIP-seq
MIRT2450822	hsa-miR-4768-3p	CLIP-seq
MIRT2450823	hsa-miR-510	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	18483184
ETS1	Activation	15300220

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	1655761
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	7838118, 8391296
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1655761
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0008188	Function	Neuropeptide receptor activity	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	1655761
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	TAS	7838118
GO:0016020	Component	Membrane	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	ISS
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0061744	Process	Motor behavior	IEA
GO:0061744	Process	Motor behavior	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	IEA
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS
GO:2000987	Process	Positive regulation of behavioral fear response	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

Other IDs

• MIM: 305670
• HGNC: 4609
• e!Ensembl: ENSG00000126010

Protein

• UniProt ID: P30550
• Protein name: Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring bombesin receptor)
• Protein function: Receptor for gastrin-releasing peptide (GRP) (PubMed:1655761). Signals via association with G proteins that activate a phosphatidylinositol-calcium second messenger system, resulting in Akt phosphorylation. Contributes to the regulation of food
• PDB: 7W3Z, 7W40, 7W41, 8H0Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 323	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pancreas (PubMed:11245983). Also expressed in stomach, adrenal cortex and brain (PubMed:11245983). In brain, expressed in cells throughout the cortex (PubMed:34610277). {ECO:0000269|PubMed:11245983, ECO:0000269|PubM
• Sequence:

  MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
  LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
  LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
  LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
  AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
  FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
  LKSTNPSVATFSLINGNICHERYV

• Sequence length: 384

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRPR-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	12720295		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19642024		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	17097693		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	24912045		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12720295		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18393381		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	14729406, 16611092, 18393381, 9259269		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12569606	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20540537, 23265893, 23728918, 26251419, 28107508, 28280221, 29097932, 29137110, 29464003, 29864700, 30036253, 30645633		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18199617, 19631337, 26251419, 27446498, 28107508, 29464003, 30645633, 31664083, 38342656	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23618860	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11981207	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12862428		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10620630, 1655761, 26577829, 28636973		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16909223, 20012906	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	16751613, 33246011, 37238733	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19642024		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27539743		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12720295		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12720295		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14747448	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21474968		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15890713, 16920698, 21281799, 24958816, 9366567	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15452158	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	21254899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrinoma	Gastrinoma	BEFREE	29864700, 8943970		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	14747448, 18483184	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	18483184		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	16909223	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26780458, 29929115		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29929115	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26780458, 29721096, 29929115		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26449838	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17431120	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22296619, 25630799, 30867055	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27539743		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33530940	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30144073		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12220644, 1655761, 22296774, 24377816	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15967120		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38342656	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20540537, 23265893, 26251419, 28107508, 28280221, 29097932, 29137110, 29464003, 29664606, 29864700, 30036253, 30645633, 31546458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	24894852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10620630, 11880476, 1655761, 26577829, 28636973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10828496		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10679759, 12839933, 19876914, 19910427, 21739464, 24894852, 25586565, 27493267, 27493272, 27516447, 28129446, 28711565, 28979118, 29084827, 29097932, 29123014, 29154145, 29254329, 29256046, 29556947, 30278325, 30763290, 30775647, 30836254, 30871262, 31025163, 31077356, 31161459, 31227055, 31264168, 31340483, 31366895, 31398865, 31540122, 31715025, 31745219		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17204703		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12720295, 19115523, 23728918, 26577829, 27493272, 28108545, 29097932, 29410320, 29587479, 29864700, 30775647, 30961511, 31715025, 31813224		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12720295		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30645633		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19642024		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	17097693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	21254899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	24912045		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	19910427		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	17852785	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037188, 10828496, 11485826, 11880476, 12474049, 12720295, 12862428, 18753628, 19115523, 19173600, 19876914, 19910427, 20540537, 21739464, 25586565, 26577829, 27609789, 28107508, 28280221, 28351312, 28636973, 28761146, 29097932, 29123014, 29517903, 29587479, 29864700, 30763290, 30963606, 31366895, 31519003, 31601697, 9406692, 9815798		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30144073		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	16611092		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11981207, 17401458, 20017961, 23155231, 23618860, 23889963, 24108003, 25630799	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15300220, 15849504, 18753628, 19426821, 23211542, 23468863, 23749575, 23806264, 24108003, 25630799		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12569606, 17349623, 8018339		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28489853, 32153512	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28280221		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19910427, 28485418, 29254329, 30763290		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10816627	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	18452185, 18663369, 24912045		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10679759, 19876914, 19910427, 21739464, 22248281, 24894852, 25586565, 27493267, 27493272, 27516447, 28129446, 28711565, 28979118, 29084827, 29097932, 29123014, 29154145, 29254329, 29256046, 29542916, 29556947, 30278325, 30763290, 30775647, 30836254, 30871262, 31025163, 31077356, 31161459, 31227055, 31264168, 31340483, 31366895, 31398865, 31540122, 31715025, 31745219, 9495364		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12409226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17204703		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19173600, 19876914, 19910427, 29154145, 30278325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21745389, 22296619, 24464532, 24727373, 27542219, 29084827, 29123014, 31017093, 31682594, 33789933, 39629134	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15879878		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29415905		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	18663369		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22735756		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12474049, 12569606		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	12474049, 12771999		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12474049, 12569606, 1310003, 22296619	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17431120	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22431275	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11880476, 18316548, 22431275		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10912998	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31664083		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31664083	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	LHGDN	15941862		★☆☆☆☆ Found in Text Mining only