Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	292
Gene name	Solute carrier family 25 member 5
Gene symbol	SLC25A5
Synonyms (NCBI Gene)	2F1AAC2ANT2T2T3
Chromosome	X
Chromosome location	Xq24
Summary	This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix i

259

Show/Hide all (259)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050085	hsa-miR-26a-5p	CLASH	23622248
MIRT047644	hsa-miR-10a-5p	CLASH	23622248
MIRT047467	hsa-miR-10b-5p	CLASH	23622248
MIRT046196	hsa-miR-27b-3p	CLASH	23622248
MIRT044296	hsa-miR-106b-5p	CLASH	23622248
MIRT044064	hsa-miR-361-5p	CLASH	23622248
MIRT040669	hsa-miR-92b-3p	CLASH	23622248
MIRT037259	hsa-miR-877-5p	CLASH	23622248
MIRT052814	hsa-miR-3198	CLASH	23622248
MIRT438754	hsa-miR-636	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23306701
MIRT438754	hsa-miR-636	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23306701
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357388	hsa-miR-134	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357400	hsa-miR-3118	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT1357403	hsa-miR-3136-5p	CLIP-seq
MIRT1357404	hsa-miR-3145-3p	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357416	hsa-miR-4439	CLIP-seq
MIRT1357417	hsa-miR-4459	CLIP-seq
MIRT1357418	hsa-miR-4513	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT1357422	hsa-miR-4760-5p	CLIP-seq
MIRT1357423	hsa-miR-4768-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357427	hsa-miR-515-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357388	hsa-miR-134	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357400	hsa-miR-3118	CLIP-seq
MIRT1357403	hsa-miR-3136-5p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357416	hsa-miR-4439	CLIP-seq
MIRT1357418	hsa-miR-4513	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT2624385	hsa-miR-4496	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq
MIRT1357386	hsa-miR-1245b-3p	CLIP-seq
MIRT1357387	hsa-miR-1305	CLIP-seq
MIRT1357389	hsa-miR-135a	CLIP-seq
MIRT1357390	hsa-miR-135b	CLIP-seq
MIRT1357391	hsa-miR-137	CLIP-seq
MIRT1357392	hsa-miR-190	CLIP-seq
MIRT1357393	hsa-miR-190b	CLIP-seq
MIRT1357394	hsa-miR-2115	CLIP-seq
MIRT1357395	hsa-miR-2277-3p	CLIP-seq
MIRT1357396	hsa-miR-2681	CLIP-seq
MIRT1357397	hsa-miR-27a	CLIP-seq
MIRT1357398	hsa-miR-27b	CLIP-seq
MIRT1357399	hsa-miR-3064-3p	CLIP-seq
MIRT1357401	hsa-miR-3119	CLIP-seq
MIRT1357402	hsa-miR-3121-3p	CLIP-seq
MIRT2105833	hsa-miR-3148	CLIP-seq
MIRT1357405	hsa-miR-3658	CLIP-seq
MIRT2330312	hsa-miR-3660	CLIP-seq
MIRT1357406	hsa-miR-3688-3p	CLIP-seq
MIRT1357407	hsa-miR-369-3p	CLIP-seq
MIRT1357408	hsa-miR-374a	CLIP-seq
MIRT1357409	hsa-miR-374b	CLIP-seq
MIRT1357410	hsa-miR-374c	CLIP-seq
MIRT1357411	hsa-miR-3977	CLIP-seq
MIRT1357412	hsa-miR-410	CLIP-seq
MIRT2105834	hsa-miR-4251	CLIP-seq
MIRT1357413	hsa-miR-4252	CLIP-seq
MIRT1357414	hsa-miR-4294	CLIP-seq
MIRT1357415	hsa-miR-4433	CLIP-seq
MIRT2624385	hsa-miR-4496	CLIP-seq
MIRT2330313	hsa-miR-4526	CLIP-seq
MIRT1357419	hsa-miR-4666-3p	CLIP-seq
MIRT2105835	hsa-miR-4668-3p	CLIP-seq
MIRT2105836	hsa-miR-4668-5p	CLIP-seq
MIRT1357420	hsa-miR-4715-3p	CLIP-seq
MIRT1357421	hsa-miR-4716-3p	CLIP-seq
MIRT2105837	hsa-miR-4738-3p	CLIP-seq
MIRT1357424	hsa-miR-4795-3p	CLIP-seq
MIRT1357425	hsa-miR-490-5p	CLIP-seq
MIRT1357426	hsa-miR-513a-5p	CLIP-seq
MIRT1357428	hsa-miR-516a-3p	CLIP-seq
MIRT2105838	hsa-miR-539	CLIP-seq
MIRT1357429	hsa-miR-548a-3p	CLIP-seq
MIRT2105839	hsa-miR-548c-3p	CLIP-seq
MIRT1357430	hsa-miR-548e	CLIP-seq
MIRT1357431	hsa-miR-548f	CLIP-seq
MIRT1357432	hsa-miR-582-3p	CLIP-seq
MIRT2105840	hsa-miR-625	CLIP-seq
MIRT1357433	hsa-miR-627	CLIP-seq
MIRT1357434	hsa-miR-655	CLIP-seq
MIRT1357435	hsa-miR-656	CLIP-seq
MIRT1357436	hsa-miR-665	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000295	Function	Adenine nucleotide transmembrane transporter activity	IMP	19116139
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005471	Function	ATP:ADP antiporter activity	IEA
GO:0005471	Function	ATP:ADP antiporter activity	ISS
GO:0005515	Function	Protein binding	IPI	17715127, 19116139, 19130895, 19154410, 21370995, 24725412, 27499296, 31883789
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005757	Component	Mitochondrial permeability transition pore complex	IEA
GO:0005757	Component	Mitochondrial permeability transition pore complex	ISS
GO:0005886	Component	Plasma membrane	TAS	2168878
GO:0007059	Process	Chromosome segregation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	19154410
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015207	Function	Adenine transmembrane transporter activity	TAS	2168878
GO:0015297	Function	Antiporter activity	IEA
GO:0015853	Process	Adenine transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	27641616
GO:0016020	Component	Membrane	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	IEA
GO:0017077	Function	Oxidative phosphorylation uncoupler activity	ISS
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	ISS
GO:0051503	Process	Adenine nucleotide transport	IMP	19116139
GO:0055085	Process	Transmembrane transport	IEA
GO:0071817	Component	MMXD complex	IDA	20797633
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	ISS
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IBA
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IMP	19154410
GO:1901526	Process	Positive regulation of mitophagy	IEA
GO:1901526	Process	Positive regulation of mitophagy	ISS
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS

MIM	HGNC	e!Ensembl
300150	10991	ENSG00000005022

P05141

Protein name

ADP/ATP translocase 2 (ADP,ATP carrier protein 2) (ADP,ATP carrier protein, fibroblast isoform) (Adenine nucleotide translocator 2) (ANT 2) (Solute carrier family 25 member 5) [Cleaved into: ADP/ATP translocase 2, N-terminally processed]

Protein function

ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity). Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): oper

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	4 → 103	Mitochondrial carrier protein	Family
PF00153	Mito_carr	109 → 206	Mitochondrial carrier protein	Family
PF00153	Mito_carr	206 → 298	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.

Sequence

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT

Sequence length

298

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cGMP-PKG signaling pathway Necroptosis Cellular senescence Neutrophil extracellular trap formation Alzheimer disease Parkinson disease Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases Influenza A Human T-cell leukemia virus 1 infection Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC25A5-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	25613378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20650008, 20875141, 22198296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30397354, 35919504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35288533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19140237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30406146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	18809618, 25833713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16107323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16107323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35288533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35840882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22034909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	8688152, 8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32515122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23783460		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasm	Kidney Neoplasm	BEFREE	8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23242177, 23306701, 24054501, 27012708, 28350139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19140237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20650008, 20875141, 22198296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20875141, 26883272, 28350139, 30225759, 8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18267033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	18809618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33462268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	25833713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20950584, 24054501, 27012708, 30225759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26883272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	8688152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25351201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8781539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34530829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	21108393		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC25A5 (solute carrier family 25 member 5)