GRM7 (glutamate metabotropic receptor 7)

Gene

• Entrez ID: 2917
• Gene name: Glutamate metabotropic receptor 7
• Gene symbol: GRM7
• Synonyms (NCBI Gene): GLUR7, GPRC1G, MGLU7, MGLUR7, NEDSHBA, PPP1R87
• Chromosome: 3
• Chromosome location: 3p26.1
• Summary: L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be pert

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1114167298	T>C	Likely-pathogenic	Missense variant, upstream transcript variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs1114167300	C>T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1114167301	C>A,T	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000073	hsa-miR-34a-5p	Review, qRT-PCR	20388499
MIRT000073	hsa-miR-34a-5p	Review, qRT-PCR	20388499
MIRT000073	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT1035267	hsa-miR-205	CLIP-seq
MIRT1035268	hsa-miR-3124-3p	CLIP-seq
MIRT1035269	hsa-miR-4668-3p	CLIP-seq
MIRT1035270	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IBA
GO:0001642	Function	Group III metabotropic glutamate receptor activity	IDA	9144652, 9473604
GO:0001662	Process	Behavioral fear response	IMP	17167337
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	18599484
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	33500274
GO:0005886	Component	Plasma membrane	NAS	9473604
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IDA	9630572
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	9144652
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IDA	9473604
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IEA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA
GO:0007268	Process	Chemical synaptic transmission	IDA	9473604
GO:0007605	Process	Sensory perception of sound	IMP	19047183
GO:0008066	Function	Glutamate receptor activity	IDA	9473604
GO:0008066	Function	Glutamate receptor activity	IEA
GO:0010855	Function	Adenylate cyclase inhibitor activity	IDA	9144652, 9473604
GO:0014050	Process	Negative regulation of glutamate secretion	ISS
GO:0016020	Component	Membrane	IDA	12746871
GO:0016020	Component	Membrane	IEA
GO:0016595	Function	Glutamate binding	IDA	9144652
GO:0030165	Function	PDZ domain binding	NAS	12052533
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IDA	9630572
GO:0032279	Component	Asymmetric synapse	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045211	Component	Postsynaptic membrane	ISS
GO:0046983	Function	Protein dimerization activity	IMP	33476302
GO:0048786	Component	Presynaptic active zone	ISS
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA
GO:0061564	Process	Axon development	IMP	33500274
GO:0070085	Process	Glycosylation	IDA	33500274
GO:0070905	Function	Serine binding	IDA	9144652

Other IDs

• MIM: 604101
• HGNC: 4599
• e!Ensembl: ENSG00000196277

Protein

• UniProt ID: Q14831
• Protein name: Metabotropic glutamate receptor 7 (mGluR7)
• Protein function: G-protein coupled receptor activated by glutamate that regulates axon outgrowth through the MAPK-cAMP-PKA signaling pathway during neuronal development (PubMed:33500274). Ligand binding causes a conformation change that triggers signaling via gu
• PDB: 3MQ4, 5C5C, 7EPC, 7EPD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	77 → 486	Receptor family ligand binding region	Family
  PF07562	NCD3G	519 → 569	Nine Cysteines Domain of family 3 GPCR	Family
  PF00003	7tm_3	602 → 847	7 transmembrane sweet-taste receptor of 3 GCPR	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many areas of the brain, especially in the cerebral cortex, hippocampus, and cerebellum. Expression of GRM7 isoforms in non-neuronal tissues appears to be restricted to isoform 3 and isoform 4. {ECO:0000269|PubMed:12052533
• Sequence:

  MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
  GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
  TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
  STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
  ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
  RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
  NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
  ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
  QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
  CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
  GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
  FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
  FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
  PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
  YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
  PAAKKKYVSYNNLVI

• Sequence length: 915

Pathways

KEGG:

Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Bilateral multifocal epileptiform discharges	Pathogenic	rs1697820592	RCV001089898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Brain atrophy	Pathogenic	rs1114167298	RCV000491187	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Pathogenic	rs1114167298, rs1697820592	RCV000491187 RCV001089898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoplasia of the corpus callosum	Pathogenic	rs1114167298	RCV000491187	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypotonia	Pathogenic	rs1114167298	RCV000491187	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microcephaly	Pathogenic	rs1697820592	RCV001089898	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with seizures, hypotonia, and brain imaging abnormalities	Likely pathogenic; Pathogenic	rs112115852, rs1114167298, rs1114167300, rs1114167301, rs2470186445, rs1695081736, rs746833089, rs1390058794	RCV002222283 RCV001248848 RCV001248849 RCV001248850 RCV004595149 RCV001248851 RCV001248853 RCV001248854	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Seizure	Pathogenic	rs1114167298	RCV000491187	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE NON-SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY WITH SUPPRESSION BURSTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRM7-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	29228715		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32694537	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21368711	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23295062	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	31707215		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	31707215		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	32286009, 34273994	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	22138692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31170425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22138692, 23295062, 37964012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	22138692		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23201551, 23295062, 24815731, 25047565, 25600112, 31170425		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31707215	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23201551, 25921429, 27312574, 27788777, 31707215		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	27312574		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16958029, 20398908, 24804643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16958029, 20398908, 24804643		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24804643, 27063557	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16958029		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Breast Neoplasms	Breast neoplasm	Pubtator	21688152	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30170084		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	32286009	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	20038947, 20423346, 22287544, 23059104, 24596089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	20159343, 26391493, 29486373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	32286009	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	10690750, 25047565, 31051234		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32286009	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Benign Neonatal	Benign neonatal epilepsy	Pubtator	32286009	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Developmental and epileptic encephalopathy	Pubtator	32286009, 34273994	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39643066	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39643066	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hashimoto Disease	Hashimoto disease	Pubtator	34493981	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36010616	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	23102807, 30528655	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	30528655	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	31707215	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26866891	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	10690750		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23201551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	34273994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30569115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	20038947, 21813496, 24278217, 25690665, 26169973, 26391493, 26655190, 28989100, 31083176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	20038947		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20038947, 20398908, 20638442, 21813496, 24278217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	24185611		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	20038947, 20423346, 22287544, 23059104, 24596089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	20159343, 26391493, 29486373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26254163, 28392321		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	23201551		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	32286009, 34273994	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	22138692		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	27510426, 31170425		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30616226		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30405350, 30588231		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	21368711		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30890967		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28489853	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23102807, 29301492	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	25921429		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37279148	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30890967		★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	16958029		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	29227625		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10994646, 11163549, 15886719, 16325263, 18329248, 19351574, 19638256, 20398908, 25579050, 26254163, 26655190, 26856250, 28750581, 30610437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18329248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18329248, 19351574, 19638256, 26254163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	28750581	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30528655		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21152100	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	20038947, 20398908, 20638442, 21813496, 24278217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	21813496, 25690665, 26655190, 28989100		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	31821883		★☆☆☆☆ Found in Text Mining only