Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	29127
Gene name	Rac GTPase activating protein 1
Gene symbol	RACGAP1
Synonyms (NCBI Gene)	CDAN3BCYK4HsCYK-4ID-GAPMgcRacGAPRCGAP1
Chromosome	12
Chromosome location	12q13.12
Summary	This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This pro

574

Show/Hide all (574)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004859	hsa-miR-192-5p	Luciferase reporter assayqRT-PCR	19074876
MIRT016327	hsa-miR-193b-3p	Microarray	20304954
MIRT024375	hsa-miR-215-5p	Microarray	19074876
MIRT004859	hsa-miR-192-5p	Microarray	19074876
MIRT004859	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT029047	hsa-miR-26b-5p	Microarray	19088304
MIRT031559	hsa-miR-16-5p	Proteomics	18668040
MIRT051704	hsa-let-7e-5p	CLASH	23622248
MIRT046942	hsa-miR-221-3p	CLASH	23622248
MIRT676474	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT676473	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT397610	hsa-miR-3155a	HITS-CLIP	23824327
MIRT397613	hsa-miR-3155b	HITS-CLIP	23824327
MIRT397603	hsa-miR-484	HITS-CLIP	23824327
MIRT676472	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676471	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676470	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676469	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT676468	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT676467	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT676466	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT676465	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676464	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT676463	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT676462	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT676461	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT676460	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT573584	hsa-miR-5683	PAR-CLIP	20371350
MIRT573582	hsa-miR-2278	PAR-CLIP	20371350
MIRT337955	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT573581	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT573580	hsa-miR-4468	PAR-CLIP	20371350
MIRT573578	hsa-miR-3657	PAR-CLIP	20371350
MIRT573579	hsa-miR-4669	PAR-CLIP	20371350
MIRT573577	hsa-miR-892a	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT566133	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT337967	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT566132	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT566131	hsa-miR-4775	PAR-CLIP	20371350
MIRT566130	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT566129	hsa-miR-3658	PAR-CLIP	20371350
MIRT566128	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT566127	hsa-miR-421	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT566161	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT566160	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT566159	hsa-miR-3666	PAR-CLIP	20371350
MIRT566158	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT566157	hsa-miR-4295	PAR-CLIP	20371350
MIRT566156	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT566155	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT566154	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT566153	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT566152	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT566151	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT566150	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT566149	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT566148	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT566147	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT566146	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT566145	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT566144	hsa-miR-3662	PAR-CLIP	20371350
MIRT566143	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT566142	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT566141	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT566140	hsa-miR-1183	PAR-CLIP	20371350
MIRT337953	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT337956	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT566139	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT566138	hsa-miR-520h	PAR-CLIP	20371350
MIRT566137	hsa-miR-3137	PAR-CLIP	20371350
MIRT566136	hsa-miR-943	PAR-CLIP	20371350
MIRT566135	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT566134	hsa-miR-527	PAR-CLIP	20371350
MIRT566133	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT337967	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT566132	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT566131	hsa-miR-4775	PAR-CLIP	20371350
MIRT566130	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT566129	hsa-miR-3658	PAR-CLIP	20371350
MIRT566128	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT566127	hsa-miR-421	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT554965	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT554964	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031559	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT554963	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT554962	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT554961	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT554960	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT554959	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT554958	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT554957	hsa-miR-4310	PAR-CLIP	21572407
MIRT554956	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT554955	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT554954	hsa-miR-107	PAR-CLIP	21572407
MIRT397609	hsa-miR-3119	PAR-CLIP	21572407
MIRT554953	hsa-miR-4503	PAR-CLIP	21572407
MIRT554952	hsa-miR-7159-3p	PAR-CLIP	21572407
MIRT469648	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT469646	hsa-miR-3651	PAR-CLIP	21572407
MIRT469645	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	21572407
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	21572407
MIRT469642	hsa-miR-623	PAR-CLIP	21572407
MIRT469641	hsa-miR-204-5p	PAR-CLIP	21572407
MIRT469640	hsa-miR-211-5p	PAR-CLIP	21572407
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT469646	hsa-miR-3651	PAR-CLIP	23592263
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23592263
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23592263
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23592263
MIRT469642	hsa-miR-623	PAR-CLIP	23592263
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT676468	hsa-miR-1304-3p	PAR-CLIP	27292025
MIRT676466	hsa-miR-4772-3p	PAR-CLIP	27292025
MIRT676473	hsa-miR-6736-3p	PAR-CLIP	27292025
MIRT676467	hsa-miR-6787-3p	PAR-CLIP	27292025
MIRT676467	hsa-miR-6787-3p	PAR-CLIP	27292025
MIRT676474	hsa-miR-6890-3p	PAR-CLIP	27292025
MIRT676474	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT676473	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT397610	hsa-miR-3155a	HITS-CLIP	23824327
MIRT397613	hsa-miR-3155b	HITS-CLIP	23824327
MIRT397603	hsa-miR-484	HITS-CLIP	23824327
MIRT676472	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676471	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676470	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676469	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT676468	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT676467	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT676466	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT676465	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT676464	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT676463	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT676462	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT676461	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT676460	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT573584	hsa-miR-5683	PAR-CLIP	20371350
MIRT573582	hsa-miR-2278	PAR-CLIP	20371350
MIRT337955	hsa-miR-576-3p	PAR-CLIP	20371350
MIRT573581	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT573580	hsa-miR-4468	PAR-CLIP	20371350
MIRT573578	hsa-miR-3657	PAR-CLIP	20371350
MIRT573579	hsa-miR-4669	PAR-CLIP	20371350
MIRT573577	hsa-miR-892a	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT566133	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT337967	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT566132	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT566131	hsa-miR-4775	PAR-CLIP	20371350
MIRT566130	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT566129	hsa-miR-3658	PAR-CLIP	20371350
MIRT566128	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT566127	hsa-miR-421	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT566161	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT566160	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT566159	hsa-miR-3666	PAR-CLIP	20371350
MIRT566158	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT566157	hsa-miR-4295	PAR-CLIP	20371350
MIRT566156	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT566155	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT566154	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT566153	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT566152	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT566151	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT566150	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT566149	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT566148	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT566147	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT566146	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT566145	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT566144	hsa-miR-3662	PAR-CLIP	20371350
MIRT566143	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT566142	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT566141	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT566140	hsa-miR-1183	PAR-CLIP	20371350
MIRT337953	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT337956	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT566139	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT566138	hsa-miR-520h	PAR-CLIP	20371350
MIRT566137	hsa-miR-3137	PAR-CLIP	20371350
MIRT566136	hsa-miR-943	PAR-CLIP	20371350
MIRT566135	hsa-miR-518a-5p	PAR-CLIP	20371350
MIRT566134	hsa-miR-527	PAR-CLIP	20371350
MIRT566133	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT337967	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT566132	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT566131	hsa-miR-4775	PAR-CLIP	20371350
MIRT566130	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT566129	hsa-miR-3658	PAR-CLIP	20371350
MIRT566128	hsa-miR-552-5p	PAR-CLIP	20371350
MIRT566127	hsa-miR-421	PAR-CLIP	20371350
MIRT469648	hsa-miR-140-3p	PAR-CLIP	20371350
MIRT469646	hsa-miR-3651	PAR-CLIP	20371350
MIRT469645	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	20371350
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	20371350
MIRT469642	hsa-miR-623	PAR-CLIP	20371350
MIRT469641	hsa-miR-204-5p	PAR-CLIP	20371350
MIRT469640	hsa-miR-211-5p	PAR-CLIP	20371350
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	20371350
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	20371350
MIRT554965	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT554964	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031559	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT554963	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT554962	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT554961	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT554960	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT554959	hsa-miR-382-3p	PAR-CLIP	21572407
MIRT554958	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT554957	hsa-miR-4310	PAR-CLIP	21572407
MIRT554956	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT554955	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT554954	hsa-miR-107	PAR-CLIP	21572407
MIRT397609	hsa-miR-3119	PAR-CLIP	21572407
MIRT554953	hsa-miR-4503	PAR-CLIP	21572407
MIRT554952	hsa-miR-7159-3p	PAR-CLIP	21572407
MIRT469648	hsa-miR-140-3p	PAR-CLIP	21572407
MIRT469646	hsa-miR-3651	PAR-CLIP	21572407
MIRT469645	hsa-miR-141-5p	PAR-CLIP	21572407
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	21572407
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	21572407
MIRT469642	hsa-miR-623	PAR-CLIP	21572407
MIRT469641	hsa-miR-204-5p	PAR-CLIP	21572407
MIRT469640	hsa-miR-211-5p	PAR-CLIP	21572407
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	21572407
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	21572407
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23446348
MIRT469646	hsa-miR-3651	PAR-CLIP	23446348
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23446348
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23446348
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23446348
MIRT469642	hsa-miR-623	PAR-CLIP	23446348
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT469648	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT469646	hsa-miR-3651	PAR-CLIP	23592263
MIRT469645	hsa-miR-141-5p	PAR-CLIP	23592263
MIRT469644	hsa-miR-24-1-5p	PAR-CLIP	23592263
MIRT469643	hsa-miR-24-2-5p	PAR-CLIP	23592263
MIRT469642	hsa-miR-623	PAR-CLIP	23592263
MIRT469641	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT469640	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT469639	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT469638	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT1287094	hsa-miR-1275	CLIP-seq
MIRT1287095	hsa-miR-139-5p	CLIP-seq
MIRT1287096	hsa-miR-1587	CLIP-seq
MIRT1287097	hsa-miR-192	CLIP-seq
MIRT1287098	hsa-miR-215	CLIP-seq
MIRT1287099	hsa-miR-3147	CLIP-seq
MIRT1287100	hsa-miR-3168	CLIP-seq
MIRT1287101	hsa-miR-324-5p	CLIP-seq
MIRT1287102	hsa-miR-34c-3p	CLIP-seq
MIRT1287103	hsa-miR-3654	CLIP-seq
MIRT1287104	hsa-miR-3675-5p	CLIP-seq
MIRT1287105	hsa-miR-3682-3p	CLIP-seq
MIRT1287106	hsa-miR-3909	CLIP-seq
MIRT1287107	hsa-miR-4259	CLIP-seq
MIRT1287108	hsa-miR-4437	CLIP-seq
MIRT1287109	hsa-miR-4488	CLIP-seq
MIRT1287110	hsa-miR-4638-3p	CLIP-seq
MIRT1287111	hsa-miR-4665-5p	CLIP-seq
MIRT1287112	hsa-miR-4674	CLIP-seq
MIRT1287113	hsa-miR-4697-5p	CLIP-seq
MIRT1287114	hsa-miR-4733-5p	CLIP-seq
MIRT1287115	hsa-miR-543	CLIP-seq
MIRT1287116	hsa-miR-624	CLIP-seq
MIRT1287117	hsa-miR-656	CLIP-seq
MIRT1287118	hsa-miR-106a	CLIP-seq
MIRT1287119	hsa-miR-106b	CLIP-seq
MIRT1287120	hsa-miR-1224-5p	CLIP-seq
MIRT1287121	hsa-miR-1252	CLIP-seq
MIRT1287122	hsa-miR-130a	CLIP-seq
MIRT1287123	hsa-miR-130b	CLIP-seq
MIRT1287124	hsa-miR-134	CLIP-seq
MIRT1287125	hsa-miR-17	CLIP-seq
MIRT1287126	hsa-miR-194	CLIP-seq
MIRT1287127	hsa-miR-196a	CLIP-seq
MIRT1287128	hsa-miR-196b	CLIP-seq
MIRT1287129	hsa-miR-19a	CLIP-seq
MIRT1287130	hsa-miR-19b	CLIP-seq
MIRT1287131	hsa-miR-204	CLIP-seq
MIRT1287132	hsa-miR-20a	CLIP-seq
MIRT1287133	hsa-miR-20b	CLIP-seq
MIRT1287134	hsa-miR-211	CLIP-seq
MIRT1287135	hsa-miR-2467-3p	CLIP-seq
MIRT1287136	hsa-miR-296-3p	CLIP-seq
MIRT1287137	hsa-miR-301a	CLIP-seq
MIRT1287138	hsa-miR-301b	CLIP-seq
MIRT1287139	hsa-miR-3118	CLIP-seq
MIRT1287140	hsa-miR-3148	CLIP-seq
MIRT1287141	hsa-miR-3150b-3p	CLIP-seq
MIRT1287142	hsa-miR-3153	CLIP-seq
MIRT1287143	hsa-miR-3158-5p	CLIP-seq
MIRT1287144	hsa-miR-3164	CLIP-seq
MIRT1287100	hsa-miR-3168	CLIP-seq
MIRT1287145	hsa-miR-3175	CLIP-seq
MIRT1287146	hsa-miR-3179	CLIP-seq
MIRT1287147	hsa-miR-3202	CLIP-seq
MIRT1287148	hsa-miR-3678-3p	CLIP-seq
MIRT1287149	hsa-miR-3915	CLIP-seq
MIRT1287150	hsa-miR-3927	CLIP-seq
MIRT1287151	hsa-miR-4277	CLIP-seq
MIRT1287152	hsa-miR-4282	CLIP-seq
MIRT1287153	hsa-miR-4289	CLIP-seq
MIRT1287154	hsa-miR-4291	CLIP-seq
MIRT1287155	hsa-miR-4434	CLIP-seq
MIRT1287156	hsa-miR-4474-3p	CLIP-seq
MIRT1287157	hsa-miR-4476	CLIP-seq
MIRT1287158	hsa-miR-4501	CLIP-seq
MIRT1287159	hsa-miR-4514	CLIP-seq
MIRT1287160	hsa-miR-4516	CLIP-seq
MIRT1287161	hsa-miR-454	CLIP-seq
MIRT1287162	hsa-miR-4640-3p	CLIP-seq
MIRT1287163	hsa-miR-4646-5p	CLIP-seq
MIRT1287164	hsa-miR-4652-3p	CLIP-seq
MIRT1287165	hsa-miR-4668-5p	CLIP-seq
MIRT1287166	hsa-miR-4689	CLIP-seq
MIRT1287167	hsa-miR-4692	CLIP-seq
MIRT1287168	hsa-miR-4699-3p	CLIP-seq
MIRT1287169	hsa-miR-4704-3p	CLIP-seq
MIRT1287170	hsa-miR-4731-5p	CLIP-seq
MIRT1287114	hsa-miR-4733-5p	CLIP-seq
MIRT1287171	hsa-miR-4747-5p	CLIP-seq
MIRT1287172	hsa-miR-4784	CLIP-seq
MIRT1287173	hsa-miR-4799-5p	CLIP-seq
MIRT1287174	hsa-miR-485-5p	CLIP-seq
MIRT1287175	hsa-miR-513a-3p	CLIP-seq
MIRT1287176	hsa-miR-519a	CLIP-seq
MIRT1287177	hsa-miR-519d	CLIP-seq
MIRT1287178	hsa-miR-520g	CLIP-seq
MIRT1287179	hsa-miR-548aa	CLIP-seq
MIRT1287180	hsa-miR-616	CLIP-seq
MIRT1287117	hsa-miR-656	CLIP-seq
MIRT1287181	hsa-miR-802	CLIP-seq
MIRT1287182	hsa-miR-93	CLIP-seq
MIRT1287183	hsa-miR-103a	CLIP-seq
MIRT1287184	hsa-miR-1224-3p	CLIP-seq
MIRT1287185	hsa-miR-125a-5p	CLIP-seq
MIRT1287186	hsa-miR-125b	CLIP-seq
MIRT1287187	hsa-miR-1260	CLIP-seq
MIRT1287188	hsa-miR-1260b	CLIP-seq
MIRT1287189	hsa-miR-1280	CLIP-seq
MIRT1287190	hsa-miR-15a	CLIP-seq
MIRT1287191	hsa-miR-15b	CLIP-seq
MIRT1287192	hsa-miR-16	CLIP-seq
MIRT1287193	hsa-miR-186	CLIP-seq
MIRT1287194	hsa-miR-188-3p	CLIP-seq
MIRT1287195	hsa-miR-195	CLIP-seq
MIRT1287127	hsa-miR-196a	CLIP-seq
MIRT1287128	hsa-miR-196b	CLIP-seq
MIRT1287196	hsa-miR-2355-5p	CLIP-seq
MIRT1287136	hsa-miR-296-3p	CLIP-seq
MIRT1287197	hsa-miR-3127-3p	CLIP-seq
MIRT1287198	hsa-miR-3156-3p	CLIP-seq
MIRT1287199	hsa-miR-3620	CLIP-seq
MIRT1287150	hsa-miR-3927	CLIP-seq
MIRT1287200	hsa-miR-424	CLIP-seq
MIRT1287153	hsa-miR-4289	CLIP-seq
MIRT1287201	hsa-miR-4301	CLIP-seq
MIRT1287202	hsa-miR-4319	CLIP-seq
MIRT1287203	hsa-miR-4324	CLIP-seq
MIRT1287204	hsa-miR-4329	CLIP-seq
MIRT1287162	hsa-miR-4640-3p	CLIP-seq
MIRT1287164	hsa-miR-4652-3p	CLIP-seq
MIRT1287205	hsa-miR-497	CLIP-seq
MIRT1287180	hsa-miR-616	CLIP-seq
MIRT1287162	hsa-miR-4640-3p	CLIP-seq
MIRT1287162	hsa-miR-4640-3p	CLIP-seq
MIRT2085053	hsa-miR-146a	CLIP-seq
MIRT2085054	hsa-miR-146b-5p	CLIP-seq
MIRT1287126	hsa-miR-194	CLIP-seq
MIRT2085055	hsa-miR-2116	CLIP-seq
MIRT1287135	hsa-miR-2467-3p	CLIP-seq
MIRT1287143	hsa-miR-3158-5p	CLIP-seq
MIRT1287148	hsa-miR-3678-3p	CLIP-seq
MIRT1287163	hsa-miR-4646-5p	CLIP-seq
MIRT1287169	hsa-miR-4704-3p	CLIP-seq
MIRT1287170	hsa-miR-4731-5p	CLIP-seq
MIRT1287171	hsa-miR-4747-5p	CLIP-seq
MIRT2085056	hsa-miR-589	CLIP-seq
MIRT1287181	hsa-miR-802	CLIP-seq
MIRT1287107	hsa-miR-4259	CLIP-seq
MIRT1287183	hsa-miR-103a	CLIP-seq
MIRT1287118	hsa-miR-106a	CLIP-seq
MIRT1287119	hsa-miR-106b	CLIP-seq
MIRT1287124	hsa-miR-134	CLIP-seq
MIRT2310546	hsa-miR-150	CLIP-seq
MIRT1287190	hsa-miR-15a	CLIP-seq
MIRT1287191	hsa-miR-15b	CLIP-seq
MIRT1287192	hsa-miR-16	CLIP-seq
MIRT1287125	hsa-miR-17	CLIP-seq
MIRT2310547	hsa-miR-1911	CLIP-seq
MIRT1287195	hsa-miR-195	CLIP-seq
MIRT1287132	hsa-miR-20a	CLIP-seq
MIRT1287133	hsa-miR-20b	CLIP-seq
MIRT2310548	hsa-miR-23a	CLIP-seq
MIRT2310549	hsa-miR-23b	CLIP-seq
MIRT2310550	hsa-miR-23c	CLIP-seq
MIRT1287135	hsa-miR-2467-3p	CLIP-seq
MIRT2310551	hsa-miR-302a	CLIP-seq
MIRT2310552	hsa-miR-302b	CLIP-seq
MIRT2310553	hsa-miR-302c	CLIP-seq
MIRT2310554	hsa-miR-302d	CLIP-seq
MIRT2310555	hsa-miR-302e	CLIP-seq
MIRT1287139	hsa-miR-3118	CLIP-seq
MIRT2310556	hsa-miR-3145-3p	CLIP-seq
MIRT1287143	hsa-miR-3158-5p	CLIP-seq
MIRT1287144	hsa-miR-3164	CLIP-seq
MIRT2310557	hsa-miR-330-3p	CLIP-seq
MIRT2310558	hsa-miR-3613-5p	CLIP-seq
MIRT1287148	hsa-miR-3678-3p	CLIP-seq
MIRT2310559	hsa-miR-372	CLIP-seq
MIRT2310560	hsa-miR-373	CLIP-seq
MIRT1287200	hsa-miR-424	CLIP-seq
MIRT1287152	hsa-miR-4282	CLIP-seq
MIRT1287155	hsa-miR-4434	CLIP-seq
MIRT2310561	hsa-miR-4459	CLIP-seq
MIRT1287158	hsa-miR-4501	CLIP-seq
MIRT1287160	hsa-miR-4516	CLIP-seq
MIRT1287163	hsa-miR-4646-5p	CLIP-seq
MIRT2310562	hsa-miR-4695-5p	CLIP-seq
MIRT2310563	hsa-miR-4700-3p	CLIP-seq
MIRT1287169	hsa-miR-4704-3p	CLIP-seq
MIRT1287170	hsa-miR-4731-5p	CLIP-seq
MIRT1287171	hsa-miR-4747-5p	CLIP-seq
MIRT1287174	hsa-miR-485-5p	CLIP-seq
MIRT1287205	hsa-miR-497	CLIP-seq
MIRT2310564	hsa-miR-512-3p	CLIP-seq
MIRT1287175	hsa-miR-513a-3p	CLIP-seq
MIRT1287177	hsa-miR-519d	CLIP-seq
MIRT2310565	hsa-miR-520a-3p	CLIP-seq
MIRT2310566	hsa-miR-520b	CLIP-seq
MIRT2310567	hsa-miR-520c-3p	CLIP-seq
MIRT2310568	hsa-miR-520d-3p	CLIP-seq
MIRT2310569	hsa-miR-520e	CLIP-seq
MIRT1287178	hsa-miR-520g	CLIP-seq
MIRT2310570	hsa-miR-634	CLIP-seq
MIRT1287117	hsa-miR-656	CLIP-seq
MIRT1287181	hsa-miR-802	CLIP-seq
MIRT1287182	hsa-miR-93	CLIP-seq
MIRT1287127	hsa-miR-196a	CLIP-seq
MIRT1287128	hsa-miR-196b	CLIP-seq
MIRT1287136	hsa-miR-296-3p	CLIP-seq
MIRT2606975	hsa-miR-361-5p	CLIP-seq
MIRT2606976	hsa-miR-3653	CLIP-seq
MIRT1287150	hsa-miR-3927	CLIP-seq
MIRT1287107	hsa-miR-4259	CLIP-seq
MIRT1287153	hsa-miR-4289	CLIP-seq
MIRT1287164	hsa-miR-4652-3p	CLIP-seq
MIRT1287180	hsa-miR-616	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CUX1	Unknown	21886810
E2F1	Unknown	21886810

Show/Hide all (70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000281	Process	Mitotic cytokinesis	IC	18511905
GO:0000281	Process	Mitotic cytokinesis	IDA	11085985, 19468302
GO:0000281	Process	Mitotic cytokinesis	IMP	16236794, 23235882
GO:0000915	Process	Actomyosin contractile ring assembly	IMP	16129829
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10979956
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	15642749
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	11278976, 11782313, 12590651, 12689593, 14744859, 16103226, 16129829, 16236794, 18201571, 18511905, 19468300, 19468302, 22580824, 22750944, 25068414, 25074804, 25416956, 26496610, 32203420, 32296183, 33961781, 35271311
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	23235882
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11085985, 11782313, 16103226, 18445686
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005819	Component	Spindle	IDA	18445686
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEP	12590651
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007405	Process	Neuroblast proliferation	ISS
GO:0008017	Function	Microtubule binding	IDA	11782313
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	23235882
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	19468302
GO:0030154	Process	Cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IMP	34818416
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	11782313, 16103226, 18511905
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	11782313
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032154	Component	Cleavage furrow	IBA
GO:0032154	Component	Cleavage furrow	IDA	16103226
GO:0032154	Component	Cleavage furrow	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IDA	16103226
GO:0032467	Process	Positive regulation of cytokinesis	IMP	11782313, 15642749
GO:0043014	Function	Alpha-tubulin binding	IDA	11085985
GO:0043015	Function	Gamma-tubulin binding	IDA	11085985
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048487	Function	Beta-tubulin binding	IDA	11085985
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051233	Component	Spindle midzone	IBA
GO:0051233	Component	Spindle midzone	IDA	19468302
GO:0051256	Process	Mitotic spindle midzone assembly	IBA
GO:0051256	Process	Mitotic spindle midzone assembly	IDA	16103226
GO:0051301	Process	Cell division	IEA
GO:0051988	Process	Regulation of attachment of spindle microtubules to kinetochore	IMP	15642749
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0072686	Component	Mitotic spindle	IDA	16103226
GO:0072686	Component	Mitotic spindle	IMP	15642749
GO:0090543	Component	Flemming body	IEA
GO:0097149	Component	Centralspindlin complex	IBA
GO:0097149	Component	Centralspindlin complex	IDA	11782313, 16236794
GO:1902358	Process	Sulfate transmembrane transport	IDA	11278976

MIM	HGNC	e!Ensembl
604980	9804	ENSG00000161800

Q9H0H5

Protein name

Rac GTPase-activating protein 1 (Male germ cell RacGap) (MgcRacGAP) (Protein CYK4 homolog) (CYK4) (HsCYK-4)

Protein function

Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Required for proper attachment of the midbody to the

PDB

2OVJ , 3W6R , 3WPQ , 3WPS , 4B6D , 5C2J , 5C2K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	287 → 338	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00620	RhoGAP	363 → 511	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, thymus and placenta. Expressed at lower levels in spleen and peripheral blood lymphocytes. In testis, expression is restricted to germ cells with the highest levels of expression found in spermatocytes. Expr

Sequence

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKR
EKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWS
QFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLTKNTPRFGSKSKSATNLGRQGNFFASPMLK

Sequence length

632

Interactions

View interactions

	Reactome
			Rho GTPase cycle MHC class II antigen presentation COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Anemia, congenital dyserythropoietic, type IIIb	Pathogenic	rs1948102480, rs760038605, rs1264268274	RCV004564729 RCV003320382 RCV003320490	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Anemia, congenital dyserythropoietic, type IIIb, autosomal recessive	Pathogenic	rs760038605, rs1264268274	RCV001848616 RCV002463185	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DYSERYTHROPOIETIC ANEMIA TYPE III	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DYSERYTHROPOIETIC ANEMIA, TYPE III	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29483831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30511377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23096218, 23135572, 29095547, 31037764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23497539, 27216196, 29095547, 31638237, 32616754, 33959662, 36726984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28901457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22539975, 28901457, 30702595, 31811111, 31822116, 33946043, 36553600, 37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35958019	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30511377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24274472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29095547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29483831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29095547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	27121792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25568185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29095547, 37945594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	27121792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29095547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31216559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37480569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	37480569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15284113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21825042, 22539975, 30009820, 31160556, 31506425, 31629962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36726984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29095547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23096218, 23135572, 29095547, 31037764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24274472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27908592, 29695400, 31306099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24615626, 26778597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30511377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25475728, 27121792, 30009820, 31426369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15863513		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25475728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23525949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37480569, 37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23262785, 23525949, 24615626, 25568185, 25617497, 26778597, 27259241, 29095547, 30009820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23225332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30866526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29483831, 37391503	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	27908592, 29695400, 31306099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22801071, 29695400, 31306099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27259241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26018753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37452322, 37480569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26018753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24615626, 26778597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26778597, 29095547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	26404029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	27121792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30816541, 35831303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RACGAP1 (Rac GTPase activating protein 1)