CD274 (CD274 molecule)

Gene

• Entrez ID: 29126
• Gene name: CD274 molecule
• Gene symbol: CD274
• Synonyms (NCBI Gene): ADMIO5, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT003923	hsa-miR-513a-5p	Luciferase reporter assay, Western blot	19155478
MIRT027156	hsa-miR-103a-3p	Sequencing	20371350
MIRT031920	hsa-miR-16-5p	Sequencing	20371350
MIRT053484	hsa-miR-570-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22190470
MIRT053484	hsa-miR-570-3p	Luciferase reporter assay	23430453
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438407	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438406	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438405	hsa-miR-363-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438404	hsa-miR-326	Luciferase reporter assay, qRT-PCR	24577056
MIRT438403	hsa-miR-940	Luciferase reporter assay, qRT-PCR	24577056
MIRT438402	hsa-miR-665	Luciferase reporter assay, qRT-PCR	24577056
MIRT438401	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438400	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438399	hsa-miR-601	Luciferase reporter assay, qRT-PCR	24577056
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438397	hsa-miR-380-5p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438396	hsa-miR-885-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT438395	hsa-miR-593-3p	Luciferase reporter assay, qRT-PCR	24577056
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT732233	hsa-miR-138-5p	Luciferase reporter assay, Western blot	27248318
MIRT031920	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT733233	hsa-miR-377-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	32550825
MIRT438398	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33821473
MIRT031920	hsa-miR-16-5p	Luciferase reporter assay, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33330451
MIRT735524	hsa-let-7d-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	32746878
MIRT736542	hsa-miR-320a	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR	32929059
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT379487	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445295	hsa-miR-4496	PAR-CLIP	22100165
MIRT445294	hsa-miR-875-3p	PAR-CLIP	22100165
MIRT445293	hsa-miR-6128	PAR-CLIP	22100165
MIRT445292	hsa-miR-4790-3p	PAR-CLIP	22100165
MIRT445291	hsa-miR-103a-2-5p	PAR-CLIP	22100165
MIRT445290	hsa-miR-1299	PAR-CLIP	22100165
MIRT445289	hsa-miR-516b-5p	PAR-CLIP	22100165
MIRT445288	hsa-miR-4782-5p	PAR-CLIP	22100165
MIRT445287	hsa-miR-5706	PAR-CLIP	22100165
MIRT445286	hsa-miR-3977	PAR-CLIP	22100165
MIRT393962	hsa-miR-3978	PAR-CLIP	22100165
MIRT756213	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR	36352176
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874429	hsa-miR-15a	CLIP-seq
MIRT874430	hsa-miR-15b	CLIP-seq
MIRT874431	hsa-miR-16	CLIP-seq
MIRT874432	hsa-miR-195	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT874434	hsa-miR-3146	CLIP-seq
MIRT874435	hsa-miR-339-5p	CLIP-seq
MIRT874436	hsa-miR-362-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874439	hsa-miR-410	CLIP-seq
MIRT874440	hsa-miR-424	CLIP-seq
MIRT874441	hsa-miR-4287	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874443	hsa-miR-4469	CLIP-seq
MIRT874444	hsa-miR-4685-3p	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874446	hsa-miR-4713-5p	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874448	hsa-miR-4793-5p	CLIP-seq
MIRT874449	hsa-miR-497	CLIP-seq
MIRT874450	hsa-miR-500b	CLIP-seq
MIRT874451	hsa-miR-501-5p	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2196300	hsa-miR-138	CLIP-seq
MIRT2196301	hsa-miR-141	CLIP-seq
MIRT2196302	hsa-miR-200a	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT874433	hsa-miR-3117-5p	CLIP-seq
MIRT2196304	hsa-miR-3133	CLIP-seq
MIRT2196305	hsa-miR-377	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT2196306	hsa-miR-4694-3p	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT874428	hsa-miR-1224-5p	CLIP-seq
MIRT874437	hsa-miR-3670	CLIP-seq
MIRT874438	hsa-miR-3915	CLIP-seq
MIRT874442	hsa-miR-4448	CLIP-seq
MIRT874445	hsa-miR-4689	CLIP-seq
MIRT874447	hsa-miR-4751	CLIP-seq
MIRT2385728	hsa-miR-489	CLIP-seq
MIRT874452	hsa-miR-556-5p	CLIP-seq
MIRT2196298	hsa-miR-1207-3p	CLIP-seq
MIRT2196303	hsa-miR-2115	CLIP-seq
MIRT2196307	hsa-miR-4718	CLIP-seq
MIRT2196308	hsa-miR-516a-3p	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499290	hsa-miR-1258	CLIP-seq
MIRT2499291	hsa-miR-1267	CLIP-seq
MIRT2499292	hsa-miR-148a	CLIP-seq
MIRT2499293	hsa-miR-148b	CLIP-seq
MIRT2499294	hsa-miR-151-3p	CLIP-seq
MIRT2499295	hsa-miR-152	CLIP-seq
MIRT2499296	hsa-miR-185	CLIP-seq
MIRT2499297	hsa-miR-193a-5p	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499299	hsa-miR-3117-3p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2499301	hsa-miR-3169	CLIP-seq
MIRT2499302	hsa-miR-3173-3p	CLIP-seq
MIRT2499303	hsa-miR-3591-3p	CLIP-seq
MIRT2499304	hsa-miR-3620	CLIP-seq
MIRT2499305	hsa-miR-3664-5p	CLIP-seq
MIRT2499306	hsa-miR-4251	CLIP-seq
MIRT2499307	hsa-miR-4254	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499309	hsa-miR-4306	CLIP-seq
MIRT2499310	hsa-miR-4308	CLIP-seq
MIRT2499311	hsa-miR-4329	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499313	hsa-miR-4463	CLIP-seq
MIRT2499314	hsa-miR-4499	CLIP-seq
MIRT2499315	hsa-miR-4641	CLIP-seq
MIRT2499316	hsa-miR-4644	CLIP-seq
MIRT2499317	hsa-miR-4653-3p	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499320	hsa-miR-4759	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2499322	hsa-miR-4803	CLIP-seq
MIRT2499323	hsa-miR-520d-5p	CLIP-seq
MIRT2499324	hsa-miR-524-5p	CLIP-seq
MIRT2499325	hsa-miR-580	CLIP-seq
MIRT2499326	hsa-miR-676	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq
MIRT2499328	hsa-miR-765	CLIP-seq
MIRT2499288	hsa-miR-105	CLIP-seq
MIRT2499289	hsa-miR-1183	CLIP-seq
MIRT2196299	hsa-miR-1228	CLIP-seq
MIRT2499298	hsa-miR-28-5p	CLIP-seq
MIRT2499300	hsa-miR-3139	CLIP-seq
MIRT2677661	hsa-miR-3153	CLIP-seq
MIRT2677662	hsa-miR-3926	CLIP-seq
MIRT2499308	hsa-miR-4275	CLIP-seq
MIRT2499312	hsa-miR-4457	CLIP-seq
MIRT2499318	hsa-miR-4693-5p	CLIP-seq
MIRT2499319	hsa-miR-4731-3p	CLIP-seq
MIRT2499321	hsa-miR-4801	CLIP-seq
MIRT2677663	hsa-miR-548s	CLIP-seq
MIRT2499327	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	38377992
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	28813417
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IMP	28813410, 28813417
GO:0003713	Function	Transcription coactivator activity	IDA	32929201
GO:0005515	Function	Protein binding	IPI	18585785, 20587542, 21982860, 23417675, 26602187, 28813410, 28813417, 31000591
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	32929201
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	28813410, 28813417
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IDA	10581077
GO:0007165	Process	Signal transduction	IDA	10581077
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10581077
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0031295	Process	T cell costimulation	IBA
GO:0031295	Process	T cell costimulation	IDA	10581077
GO:0031901	Component	Early endosome membrane	IDA	28813417
GO:0031901	Component	Early endosome membrane	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IMP	12538684, 24187568
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	12538684, 24187568
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	10581077
GO:0034097	Process	Response to cytokine	IDA	17489864
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	IDA	36232715
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	TAS	10581077
GO:0042130	Process	Negative regulation of T cell proliferation	IBA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046006	Process	Regulation of activated T cell proliferation	IMP	24187568, 25310899
GO:0046007	Process	Negative regulation of activated T cell proliferation	IMP	12538684
GO:0048018	Function	Receptor ligand activity	IDA	28813410, 28813417
GO:0050868	Process	Negative regulation of T cell activation	IDA	38377992
GO:0055038	Component	Recycling endosome membrane	IDA	28813417
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0070062	Component	Extracellular exosome	IDA	17076679
GO:0070232	Process	Regulation of T cell apoptotic process	IMP	25310899
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:1903556	Process	Negative regulation of tumor necrosis factor superfamily cytokine production	IMP	24187568
GO:1905399	Process	Regulation of activated CD4-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:1905404	Process	Positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IDA	24187568
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	24691993
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IDA	28813417
GO:2001186	Process	Negative regulation of CD8-positive, alpha-beta T cell activation	IMP	28813410, 28813417

Other IDs

• MIM: 605402
• HGNC: 17635
• e!Ensembl: ENSG00000120217

Protein

• UniProt ID: Q9NZQ7
• Protein name: Programmed cell death 1 ligand 1 (PD-L1) (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD antigen CD274)
• Protein function: Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813410, PubMed:28813417, PubMed:31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cell
• PDB: 3BIK, 3BIS, 3FN3, 3SBW, 4Z18, 4ZQK, 5C3T, 5GGT, 5GRJ, 5IUS, 5J89, 5J8O, 5JDR, 5JDS, 5N2D, 5N2F, 5NIU, 5O45, 5O4Y, 5X8L, 5X8M, 5XJ4, 5XXY, 6L8R, 6NM7, 6NM8, 6NNV, 6NOJ, 6NOS, 6NP9, 6PV9, 6R3K, 6RPG, 6VQN, 6YCR, 7BEA, 7C88, 7CZD, 7DCV, 7DY7, 7NLD, 7OUN, 7SJQ, 7TPS, 7UX5, 7UXO, 7UXP, 7UXQ, 7VUN, 7XAD, 7XAE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	22 → 131	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	135 → 220	CD80-like C2-set immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. {ECO:0000269|PubMed:10581
• Sequence:

  MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
  DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
  ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
  TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
  LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET

• Sequence length: 290

Pathways

KEGG:

Cell adhesion molecules
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

PD-1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, DUCTAL, BREAST	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEONATAL DIABETES MELLITUS	—	Disgenet, GenCC Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20601920, 31585433		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	28501937, 29799076		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	31135488		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31570447		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30204524		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28705256		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	29509940		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24548766, 25009014, 25349974, 26024796, 26081225, 26801886, 27346415, 27393509, 27629881, 27846317, 27976463, 28038981, 28059094, 28104537, 28222308, 28289861, 28347537, 28385373, 28387300, 28423587, 28460468, 28502094, 28507793, 28549836, 28623908, 28795418, 28821192, 28959173, 28969070, 29036791, 29044503, 29074606, 29146060, 29191596, 29274107, 29309297, 29323731, 29510096, 29526824, 29530732, 29538329, 29600072, 29614306, 29650000, 29672836, 29713040, 29805749, 29856861, 29889673, 29901571, 30032820, 30046124, 30075155, 30077123, 30100056, 30166615, 30173944, 30257853, 30282880, 30305853, 30401947, 30405752, 30448912, 30477643, 30513627, 30514666, 30570649, 30604042, 30744655, 30769852, 30797490, 30854794, 30879776, 30900155, 30931254, 31043352, 31043417, 31081424, 31109808, 31127651, 31152546, 31383957, 31446140, 31546072, 31546725, 31561631, 31570483, 31724072, 31792836		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30045644, 30959852		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	27777774, 29116900, 29859152, 29872575, 30419350, 30852560, 30902915		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24548766, 25801750, 25895031, 26014096, 26954523, 27237031, 27342566, 27346415, 27393509, 27473266, 27568346, 27687306, 27815126, 27846317, 27976463, 28024695, 28038981, 28039262, 28104537, 28145884, 28201746, 28236980, 28341226, 28385373, 28387300, 28435290, 28451792, 28664936, 28684311, 28711324, 28829153, 28830685, 28851662, 28870260, 28932563, 28932565, 28959173, 28968265, 28982179, 29029512, 29114472, 29127022, 29135534, 29176936, 29238224, 29413045, 29510096, 29572000, 29572005, 29650000, 29677240, 29767258, 29773717, 29856861, 29858030, 30014971, 30046124, 30194181, 30197262, 30216999, 30250648, 30268486, 30275232, 30310505, 30343006, 30348714, 30367104, 30407231, 30448912, 30514666, 30521597, 30642549, 30655791, 30735165, 30744655, 30768970, 30771085, 30925904, 30964601, 30972298, 30972766, 31002007, 31021072, 31088500, 31159869, 31178388, 31221150, 31294893, 31407494, 31436252, 31462002, 31500267, 31586770, 31605439, 31644929, 31760310, 31808285, 31809311, 31814556, 31821665, 31830168		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31371279, 31423221		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	26566945, 30257853, 31545446		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	29155514		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29954240, 30418532		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27655724, 31252398		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30594747		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30400026, 30413322		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	38415841	Associate	★☆☆☆☆ Found in Text Mining only
ADRENOCORTICAL CARCINOMA, HEREDITARY	Adrenocortical carcinoma	BEFREE	26014098		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31570447, 31796119		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	29509940		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27564404, 28427522, 28685821, 29246182, 29748856, 30033844, 30197796, 30286249, 30389217, 30449068, 30458835, 30601579, 30666052, 30683910, 30884772, 30917792, 31007846, 31150165, 31197205, 31493237, 31679792		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26049755, 28497159, 28514441, 28683452, 28893733, 29255458, 29380399, 29449276, 29521140, 29698935, 29775689, 30384489, 30458835, 30564891, 31456438, 31471540, 31699300		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	27463676, 28474991, 29399402, 29721192		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18830259		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	27281199, 27564404, 29297942, 30630986, 31704289, 31775585		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	29419471		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30400026, 31646101		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	40671151	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31269820, 31598989		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28777458, 31096532		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	28777458		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	31625205		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	28688724		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	35761436	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis Primary Cutaneous	Amyloidosis	Pubtator	28504999	Associate	★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	27849650		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30762153		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	26943572, 27045886, 28093480, 28324060, 28383817, 29996921, 30327563, 30515783, 30762153, 30913016		★☆☆☆☆ Found in Text Mining only
Andersen Syndrome	Andersen-tawil syndrome	Pubtator	34257548	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31446140		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28881642, 30019319, 30196108		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	32192573	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33952700	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	31924334, 35645132	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	31236065	Associate	★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	30688388, 30938862		★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	30285856		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21269571		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	27568346, 28264871, 32089413, 36005189, 36613564	Associate	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	33457080, 34042312, 38281914	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24942756, 27797936, 27932443, 28314962, 28870260, 29378617, 29561217, 29576277, 30031096, 30405053, 30426611, 30587556, 30670333, 30747725, 30899426, 31069140, 31135488, 31268976, 31284422, 31613799, 31771616		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	28334399, 28453692, 29700411	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28744199		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28744199		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	28245875	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30400026, 31646101		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29524567		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26615520		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	29489833, 35115362	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21739608, 29191375, 29455266, 31758536		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34691053	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	37068331	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	27542294	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17323353, 24742142, 25433812, 29489833, 30140263, 33901179, 40243636	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30327652	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37958839	Stimulate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	34022844	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29032197, 29874664		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32394602, 36804777, 37260034	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28531337, 34507430, 36580017	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	27564404	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	28496056, 35619700	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30913016		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26615520		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34082770	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25810125, 35600045	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	29730815		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	16876901, 17311651		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19828602, 26041877, 27617656, 28513984, 30325236, 32243638, 32616532, 33193306, 35615575, 35979531, 36917924, 37467751, 37930659	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19850680, 19852844, 20522597, 22039410, 24816853, 26041877, 26378076, 26554829, 28522738, 28778959, 28843709, 29097600, 29238906, 29260623, 29553950, 29609005, 29728568, 29746230, 30182073, 30269996, 30325236, 31081424, 31182340, 31412566, 31419705, 31424637, 31487265, 31692128, 31758536		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27630241	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	19852844, 35131574, 40352922	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	30347480, 31653618		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29128181, 31656199		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23674495, 27045512, 27805626, 28395108, 28402953, 28718418, 29775689, 29946193, 30025443, 30209121, 30601579, 30824609, 30867773, 30925928, 31382969, 31408531, 31731818		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22039410		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	29271790		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29535806		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	31081949		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	28332100		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	31081949		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	27780932, 32352498, 32461347, 32704067, 34907910, 35130881, 35137343, 35967452, 36123922, 36650632, 40414848	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18608206		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25730066, 25963805, 27460757, 27816403, 27987237, 28096371, 28214651, 28357911, 28423552, 28487100, 28493171, 28500617, 28579805, 28599483, 28675174, 28978000, 29133939, 29271413, 29325739, 29472240, 29553950, 29562804, 29599921, 29844686, 29855698, 29941343, 29969606, 29983890, 30003574, 30209552, 30275703, 30315148, 30344922, 30400941, 30425515, 30446009, 30463956, 30548363, 30552042, 30594037, 30606990, 30627815, 30791940, 30871066, 31011905, 31102277, 31117036, 31159302, 31190987, 31201825, 31267201, 31341011, 31385407, 31534011, 31570249, 31616289		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	32073752	Associate	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	28974264	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	33239417	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36231113	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	35610613	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	37993664	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28881488, 35105689	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	32389639	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37348508	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19028999, 26517811, 27502709, 30131293, 30451357, 30587623, 30681550, 31489465, 32017467, 32117271, 32859740, 33184096, 34021481, 34121347, 34503964, 34596346, 34670827, 35402080, 35596539, 35616216, 37349126, 37382806, 37660535, 39593098, 40421655, 40437823	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28404866, 29391205, 29730815, 30916923		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29524062	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	BEFREE	29137285		★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	32449246	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20626886, 23828443, 24551119, 24647569, 24842267, 25669979, 25940795, 26245467, 26554829, 27146558, 27221508, 27422273, 27468881, 27531819, 27589570, 27925176, 27935862, 28058578, 28079291, 28160557, 28167507, 28187748, 28195880, 28197375, 28230773, 28346916, 28373294, 28404866, 28430626, 28453554, 28572258, 28614911, 28651116, 28721684, 28731046, 28739716, 28784153, 28799073, 28843709, 28881675, 28894845, 28914717, 28936553, 29041905, 29061774, 29104508, 29118259, 29135534, 29163490, 29163540, 29168430, 29198959, 29245948, 29282694, 29438316, 29516978, 29524062, 29615063, 29672601, 29675979, 29695766, 29702007, 29789418, 29802358, 29890396, 29914097, 29929548, 29936058, 29961778, 29983831, 30064200, 30085937, 30230111, 30241942, 30393583, 30443687, 30498230, 30524905, 30547271, 30594747, 30607162, 30624770, 30627961, 30765258, 30781490, 30803931, 30866717, 30892954, 30901292, 30902796, 30904483, 30906504, 30915120, 31008945, 31022191, 31060337, 31061067, 31075727, 31081058, 31096176, 31152305, 31165561, 31217296, 31227501, 31243779, 31336685, 31398408, 31409638, 31428520, 31444294, 31455411, 31473251, 31516390, 31521537, 31581535, 31584964, 31599562, 31614877, 31641154, 31665051, 31702880, 31721331, 31727629, 31819174		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	23828443		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	37390260	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16611412, 18294387, 18850006, 24551119, 24842267, 25527356, 25669979, 25897014, 26093818, 26317899, 26378017, 26527522, 26942414, 27117582, 27531819, 27727484, 27762298, 27801993, 28160557, 28230773, 28537889, 28652380, 28731046, 28784153, 28832074, 28912897, 28963773, 29045526, 29063313, 29104508, 29516978, 29524062, 29588392, 29615076, 29672601, 29757193, 29858752, 29890396, 29983831, 30064200, 30066852, 30406203, 30451357, 30519815, 30547271, 30576871, 30770752, 30866717, 30892954, 30906504, 30914433, 31061067, 31081058, 31152305, 31243779, 31270941, 31292534, 31398408, 31420468, 31455411, 31473251, 31533777, 31584964, 31591439, 31693690, 31723167, 31796994, 31819174, 31839160, 31936263, 32111764, 32115850, 32266446, 32313717, 32393302, 32576238, 32602545, 32616706, 32672418, 32681091, 32811533, 32869930, 32871794, 32939056, 33073683, 33112575, 33176887, 33184106, 33267869, 33299660, 33413574, 33446741, 33503961, 33667790, 33672529, 33688997, 33824367, 33832505, 33972391, 34057120, 34068143, 34105210, 34115674, 34185141, 34257557, 34319029, 34392603, 34474671, 34519637, 34542773, 34599199, 34636027, 34651665, 34667028, 34741349, 34768077, 34780566, 34795307, 34975907, 35085258, 35217381, 35225058, 35345385, 35380716, 35575054, 35577913, 35610613, 35614183, 35621626, 35664082, 35669769, 35694705, 35763653, 35842661, 35927628, 35935985, 36088412, 36093688, 36207751, 36295559, 36347854, 36362023, 36404592, 36437379, 36482233, 36503417, 36522476, 36528658, 36653507, 36721218, 36725842, 36866462, 36901916, 36969745, 36976297, 36996499, 37014700, 37038006, 37106127, 37147987, 37178414, 37208129, 37222841, 37264298, 37340461, 37377974, 37388747, 37390260, 37441083, 37480115, 37592296, 37666492, 37768345, 37890351, 37898851, 38053121, 38073318, 38125697, 38206277, 38267903, 38273215, 38643462, 39209597, 39388456, 40108523, 40256728, 40362201, 40398661, 40510346, 40612859, 40666524, 40725123	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30203045, 31552680, 36423363	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31022191, 31825827	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30519815, 36614261	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	28427861		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	29630716, 30018132, 30025829		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29695237, 29946193, 30033844		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29695237	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29946193	Stimulate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37905619	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28769571		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	28351581		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27683115, 28851898, 32373223, 32929059, 33980985, 34158547, 34240739, 34681840, 35499071, 35661198, 35818041, 36802389, 38597079	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	28625622, 33037134	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25392179, 25669979, 26871470, 26918453, 27346415, 27393506, 27498988, 27697578, 27746267, 27984238, 28131992, 28405527, 28502094, 28515962, 28579805, 28623908, 28752845, 28795418, 29110857, 29190964, 29271413, 29405663, 29438172, 29535832, 29566951, 29672601, 29673110, 29736798, 29923634, 29969606, 30075155, 30075156, 30377559, 30455128, 30734108, 30898149, 30953116, 30978575, 31128036, 31152546, 31284422, 31317017, 31353229, 31406485, 31484986, 31517642		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28463396	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28671973, 28832074, 30031096, 32294103, 33155664, 33457085, 34103354, 34797780, 34949765, 34953041, 35204793, 37194064, 37926435, 40275321	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29954240, 31990894, 36169795	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	28344809, 34121347, 38101862	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16611412, 29516978	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	29516978, 30085937, 35225058	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	26598537	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	28423520	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	38148043	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19058313, 19451266, 19826049, 21674477, 21853301, 21876620, 21912640, 22396772, 26084609, 26367730, 26968206, 27456947, 27966626, 28624577, 28627705, 28928158, 29400599, 29556041, 29921949, 29999557, 30506460, 30539869, 30555574, 30854665, 30996212, 31061454, 31231126, 31295151, 31304819, 31337865, 31388642, 31442209, 31558872, 31568700, 31724091, 31727135, 31810126, 32051231, 32086577, 32100934, 32579541, 32587357, 32710922, 32724815, 32761426, 32762721, 32770259, 32802193, 32863381, 32938429, 33000204, 33099927, 33553979, 33656759, 33725827, 33860125, 33993366, 34053310, 34055974, 34104078, 34208001, 34445462, 34453221, 34478821, 34605709, 34687175, 34777920, 34958112, 34988230, 35040184, 35184646, 35266439, 35298067, 35316767, 35429078, 35567547, 35634309, 35746817, 35812439, 35907841, 35934785, 35982895, 35986302, 36062845, 36091935, 36118947, 36139065, 36146933, 36189226, 36265835, 36464675, 36482717, 36502594, 36513250, 36525476, 36707911, 36714595, 36717584, 36830729, 36896779, 36952458, 37044053, 37047287, 37099251, 37173350, 37173640, 37240068, 37248957, 37306737, 37408047, 37469973, 37489553, 37813900, 37906282, 37919059, 38048735, 38049741, 38097536, 38117780, 38243049, 38287833, 38418151, 39358478, 39471591, 39838375, 40243557, 40282408	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35226764	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	17340590, 29073638, 40010639	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26769139, 31375764, 32203210	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	28625622, 28925087, 29378266, 29713040, 33605014, 35144629, 35287068, 36263183, 38057657	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26729235, 28731046, 39388456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	26965581, 28807004, 31152546	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	32857459	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	24416729, 25550797, 28373005, 30285852, 30993371, 31786889, 32324435, 32687503, 33361404, 34071045, 36683495, 37573372, 37851052, 38241371	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	36169795	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	28502094, 31109808		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25498841, 25730066, 25963805, 27460757, 27816403, 27987237, 28096371, 28214651, 28357911, 28487100, 28493171, 28500617, 28579805, 28599483, 28675174, 28978000, 29133939, 29271413, 29325739, 29472240, 29553950, 29562804, 29599921, 29844686, 29855698, 29941343, 29983890, 30003574, 30209552, 30275703, 30315148, 30344922, 30400941, 30425515, 30446009, 30463956, 30548363, 30552042, 30594037, 30606990, 30627815, 30791940, 30871066, 31011905, 31102277, 31117036, 31159302, 31190987, 31201825, 31267201, 31341011, 31385407, 31534011, 31570249, 31610173, 31616289		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	30361911		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25862146, 25963805, 26014096, 26420858, 26473645, 26637667, 26756646, 26762740, 26883990, 26901614, 26944305, 27393506, 27393509, 27438512, 27502709, 27610620, 27747247, 27801735, 27834350, 27913228, 28024695, 28059094, 28104537, 28111119, 28114251, 28213003, 28213726, 28288993, 28302866, 28385373, 28446544, 28484456, 28577937, 28604752, 28664936, 28675453, 28679395, 28679765, 28684311, 28700789, 28714780, 28748356, 28795532, 28835513, 28849209, 28851100, 28860576, 28884747, 28925087, 28932563, 28980429, 29029512, 29031195, 29049375, 29053224, 29069824, 29088766, 29119113, 29119407, 29137398, 29152077, 29175115, 29187498, 29194117, 29212506, 29246835, 29254651, 29296193, 29306075, 29309540, 29360723, 29423109, 29426340, 29435109, 29476608, 29507487, 29510096, 29516506, 29538329, 29568386, 29607663, 29659668, 29666465, 29667757, 29675791, 29683890, 29703650, 29726585, 29736798, 29779430, 29871672, 29898990, 29937998, 29938855, 29946185, 29948020, 29997286, 30019319, 30019892, 30059678, 30061230, 30125216, 30134343, 30215300, 30253080, 30275099, 30282880, 30305853, 30367104, 30397852, 30416860, 30425525, 30429043, 30446226, 30482633, 30499814, 30514666, 30521597, 30564891, 30591531, 30616523, 30653748, 30746209, 30755403, 30760579, 30771521, 30778885, 30790069, 30815801, 30819828, 30842489, 30850589, 30860657, 30914312, 30932979, 30948928, 30958600, 30972999, 30986912, 30995715, 31002007, 31003463, 31005568, 31019805, 31021072, 31031765, 31050216, 31079031, 31145232, 31178388, 31196152, 31209979, 31294893, 31331645, 31348245, 31399559, 31404614, 31420048, 31462002, 31480591, 31513911, 31550464, 31555517, 31561203, 31561631, 31612048, 31625289, 31675543, 31740722, 31741753, 31747941, 31760310, 31801624, 31809311, 31821665		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	30519815		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26657115, 27864219, 27986748, 31105696, 31208449, 33580098, 33737722, 33804458, 34946254, 35031063, 36604635	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20976171	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26858311, 28007776, 28314962, 28602029, 28870260, 29066497, 29378617, 30031096, 30177687, 30426611, 31043417, 31284422, 32495519, 32580737, 33728352, 34108669, 34202040, 34374812, 34691034, 35037417, 35083884, 35122074, 35862858, 36325339, 36650632, 36768480, 36781839, 36944944, 37311977, 37449210, 40244011, 40246986, 40301983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15569934, 16208700, 16798883, 18355839, 18694993, 19296514, 19501877, 20208540, 20609235, 23676558, 24714771, 24778130, 24885059, 24926549, 25193987, 25225461, 26014095, 26307625, 26317902, 26424759, 26470780, 27292320, 27393506, 27491898, 27623354, 27926518, 28086852, 28187748, 28419182, 28522811, 28752845, 28832979, 29301960, 29458244, 29713040, 30131293, 30144808, 30183478, 30385260, 30407350, 30548363, 30588196, 30837581, 30972888, 30992011, 30996253, 31043837, 31393391, 31537897, 31653140, 31721643, 31732494, 31829518, 31883418, 31959726, 31991225, 32166404, 32178978, 32194829, 32245391, 32279409, 32322590, 32424467, 32493845, 32495158, 32923131, 33157048, 33208882, 33416945, 33547292, 33604999, 33605089, 33797012, 34081621, 34172722, 34291367, 34319001, 34358517, 34563045, 34616407, 34655161, 34789838, 34856762, 34953097, 35184226, 35562857, 35633190, 35802667, 35858961, 35979371, 35982911, 36074149, 36083857, 36109798, 36112410, 36241555, 36341325, 36389780, 36505457, 36534263, 36581850, 36618968, 36660930, 36683495, 36734432, 36747242, 36752726, 36775874, 36788061, 36827173, 36894965, 37108666, 37160318, 37221577, 37279009, 37419794, 37445733, 37762031, 38104891, 38420990, 39311161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31130676, 31363159	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25582496, 27566252, 27639678, 28193529, 29378266, 29843803, 30735815, 31870883, 33457428, 33839362, 39623844	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	29577933	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26313362, 27056074, 27103510, 27145277, 27158757, 27217541, 27562497, 27816392, 28008744, 28052400, 28059094, 28334399, 28341226, 28387300, 28453692, 28460468, 28671973, 28884747, 28886030, 29049375, 29057919, 29275316, 29484464, 29599344, 29634978, 29713040, 29799076, 30253973, 30291344, 30305853, 30401947, 30633894, 30854794, 31141610, 31270941, 31274701, 31299995, 31383957, 31481045, 31605439, 32025868, 32139873, 32322590, 32765198, 32884946, 32993587, 33153411, 33483624, 33637877, 33717076, 33879814, 33915250, 33979899, 34130989, 34203211, 34218257, 34257603, 34354151, 34449004, 34693652, 34716208, 34887858, 34936703, 35095878, 35195152, 35402079, 35799269, 35801411, 35881043, 35953696, 36032124, 36232331, 36280845, 36302564, 36478592, 36683495, 36701715, 36747242, 36753836, 36759392, 36776865, 36780540, 36849197, 36867945, 37305382, 37520582, 37565840, 37726695, 37821306, 38052215, 38086165, 38161143, 39694330, 40154184	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28623908, 31135485, 34384268, 34514576, 34841687, 34953041, 36333792, 36335353, 36503417	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34250747	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28259105, 28344809		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	30447298		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	25582496, 29037958, 29326364, 29378266, 29434915, 30667073, 30709785, 31011254, 31134150, 31557757		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23340297, 24297569, 25081699, 25998800, 26541760, 26573793, 26625204, 27626654, 27671674, 27864219, 27986748, 28065619, 28266500, 29055949, 29171115, 29171986, 29337305, 29485423, 29496294, 30045136, 30078505, 30167862, 30207101, 30412078, 30522700, 30582756, 30702189, 31039792, 31311810, 31432577, 31492714, 31533774, 31600397, 31611650, 31695427, 31781843, 31799599, 31821542, 31851060		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	28419182, 29146060, 29713040, 31522278		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	27801734, 29221220, 30101629		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	30101629, 34876047	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28026044		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	28026044	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated 1l	Dilated cardiomyopathy	Pubtator	36564297	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	34489963	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31924334, 32012411, 33009409, 34607896, 34668977, 34782426, 34935288, 36159840, 37839181, 38015220, 39333574	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	38172197	Associate	★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	28688724		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	32066859	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	32581063, 34220824	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29220526		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	26501438		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27721577, 27754760, 28059093, 28833798, 28870938, 28912897, 29095678, 29104629, 29403308, 29706653, 29855617, 30123362, 30397772, 30755279, 30774597, 30826965, 30943124, 31143091, 31274701, 31331818, 31348579, 31808707, 31833942		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23521696, 28833798, 29344157, 29400020		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27721577, 27754760, 28059093, 28833798, 28870938, 28912897, 29095678, 29104629, 29344157, 29403308, 29706653, 29855617, 30123362, 30397772, 30755279, 30774597, 30826965, 30943124, 31026210, 31143091, 31191020, 31274701, 31331818, 31348579, 31808707		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	30853363		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	34458163	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31570447		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27463676, 28474991, 29399402, 29721192		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24673799, 28139862, 28445951, 29805739, 30377340, 30419854, 30646854, 31081949, 31407173, 31568700, 31620360		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26373575, 27626174, 28445951, 30377340, 30419854, 30646854, 30773525, 30885276, 31367249, 31383016, 32653521, 33228682, 33239315, 33712681, 34526987, 34603331, 34616011, 35154166, 35226764, 35317832, 35418130, 35856436, 36159865, 36190545, 36251029, 36433731, 36928584, 37094985, 37787790, 38123132, 38281914, 38330461, 38547421, 39359389	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	35105689, 36341325	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	28688724, 28938660, 29862874		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	35204793	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	28832074	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	25349132, 25871477, 27172898, 29051990, 35145510	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	29051990, 30486888, 31666667		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11978065, 27362903, 28423520, 30339966, 31010836, 31013360, 31614500		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	38580043	Associate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	29277923		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28409437		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22532845, 23300177, 26140546, 26522085, 27479178, 28685821, 28754746, 29122656, 30277471, 31270810, 31496815		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28062906, 29467301, 29872567, 30851544, 31146499		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29518341, 30045644, 31002007		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28122135		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	29362922, 29490989, 30131293, 30385260, 31155004, 31383732, 31841221		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28246107, 28889921, 29123955, 29230210, 29760800, 31497192, 31704288		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	33130956, 35115362, 35427471	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27226337, 30864556	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34158547, 37273534	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	BEFREE	25193987, 30407350, 30799404, 31841221		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27196573, 27221508, 28223102, 28406723, 28938609, 28940664, 29102042, 29284010, 29742733, 29872559, 30206410, 30228206, 30353144, 30389315, 30522017, 30873025, 31105882, 31322270, 31354723, 31412307, 31570897, 31651174, 31744296, 31812723		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	36059511	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	37999119	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26464688, 29284010, 30045644, 31983188, 31992245, 33625532, 33972391, 34060360, 35151825, 35773332, 36058633, 36849197	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30898149, 31651174		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	31354723	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23785454, 23873101, 24468585, 26284927, 27196573, 27197062, 27198569, 27248318, 27404452, 27470134, 27552968, 27553906, 27720718, 27777774, 27801734, 27813511, 28055269, 28405764, 28406723, 28667193, 28782638, 28811964, 28851046, 29033182, 29044503, 29115601, 29120224, 29144791, 29208565, 29284010, 29327160, 29408916, 29492219, 29552177, 29632716, 29663398, 29779430, 29848685, 29854854, 29872568, 29884866, 29900052, 29949671, 29991744, 30087314, 30128738, 30156250, 30166615, 30172913, 30205088, 30221062, 30222314, 30250590, 30272332, 30285662, 30288357, 30353144, 30387230, 30392153, 30406373, 30519336, 30522017, 30544743, 30569297, 30609118, 30609938, 30675299, 30694411, 30698975, 30713795, 30713804, 30723297, 30723299, 30744692, 30776481, 30872332, 30873025, 30873585, 30906656, 30979816, 31110074, 31129768, 31190869, 31205530, 31275983, 31287991, 31406255, 31424670, 31444293, 31447586, 31564188, 31652644, 31680565, 31741761, 31755739, 31759368, 31776089, 31788072, 31814900, 31819512, 31836325, 31842958		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22408358, 23785454, 23873101, 24124529, 25093496, 25583798, 27196573, 27404452, 27443512, 27552968, 27777774, 27813511, 28267224, 28405764, 28406723, 29284010, 29408916, 29662888, 29854854, 29949671, 30066852, 30081950, 30128738, 30166615, 30172913, 30206410, 30285662, 30353144, 30429368, 30454021, 30670049, 30723297, 30723299, 30755167, 30770752, 30852949, 30872332, 30979816, 31061070, 31221124, 31250346, 31270941, 31275983, 31429779, 31439614, 31524634, 31683723, 31759368, 31842958, 31983188, 32265897, 32314040, 32379280, 32449240, 32577816, 32762373, 32767974, 32862585, 32962309, 33045001, 33080474, 33113363, 33238770, 33308232, 33345422, 33401247, 33557837, 33579737, 33811152, 33818637, 33826281, 33849927, 34042312, 34051513, 34054869, 34060360, 34315821, 34369992, 34377593, 34429334, 34440739, 34573357, 34743724, 34758826, 34768077, 34797860, 34814302, 34954864, 34975867, 35027037, 35038827, 35060518, 35110358, 35145164, 35181583, 35208526, 35213358, 35292828, 35427471, 35456394, 35471834, 35635229, 35748788, 35845947, 35858011, 35930112, 35937946, 36050267, 36059511, 36105798, 36131027, 36280825, 36351995, 36362062, 36389750, 36601880, 36613564, 36639643, 36656207, 36730426, 36773295, 36802389, 36846928, 36894899, 36968142, 37002343, 37004094, 37071062, 37085190, 37151285, 37172969, 37207219, 37308878, 37566222, 37647025, 37778272, 37828429, 37931529, 37986009, 37999119, 38085001, 38102227, 38150845, 38152402, 38159250, 38233811, 38302412, 39187798, 39235590, 39300184, 39456247, 39627663, 39632246, 40184080	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26933175, 29246442		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27494857, 31354723, 31424670, 32358386, 35356153	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37178411	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	29710228, 30723299, 33982365, 34275654	Associate	★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	28611201		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32575504, 33876323, 37997558	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28005469, 29444087		★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	28332100		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28624577, 30953147		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28419539, 30377340, 30646854, 31407173, 31425839, 31620360		★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1B	Congenital disorder of glycosylation	Pubtator	32093629	Associate	★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1C	Congenital disorder of glycosylation	Pubtator	34625514	Associate	★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Conjunctival disease	Pubtator	31141610	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24029602, 24778130, 25193987, 25538263, 26014095, 26141060, 26424759, 26945902, 27470134, 27491898, 27623354, 28210995, 28223273, 28353093, 28427522, 28432616, 28524003, 28550387, 28697172, 28807048, 28807336, 28832979, 29191375, 29230210, 29260622, 29262573, 29362922, 29368638, 29374054, 29423418, 29661736, 29748390, 29910061, 29942309, 29994900, 30048250, 30131293, 30144808, 30183478, 30346474, 30349421, 30372397, 30385260, 30450335, 30464501, 30498230, 30588196, 30645700, 30702014, 30777131, 30783205, 30790069, 30837208, 30854124, 30916827, 30934624, 30958600, 30972888, 30987368, 30992011, 31058656, 31060225, 31060796, 31076547, 31155004, 31383732, 31428205, 31494951, 31519573, 31557787, 31653140, 31817109, 31824835, 31829518, 31841221		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28604383		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28604383, 30333306	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33761687	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	33130956	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	29509940, 30880197		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	29509940, 32958683, 40721446	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22397822, 29327160, 29910803, 31210370, 31633754		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22397822, 30544444, 31633754, 33570446, 39199011	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32066859	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29378725		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28325255, 28680759, 28737763, 29185395, 29794562, 30373548, 30487198		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25926674, 30442491	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30442491		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	29277923		★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Dominant 1	Deafness	Pubtator	36575294	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30791745		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30692527		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30715244		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	37092578	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	16085391, 29138509, 29857011		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32430334	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30663147		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	29419471		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	34276259, 37098880	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20522597, 23977133, 28211040, 28230773, 28916112, 28978581, 29141886, 29272267, 29513874, 29844327, 31419705, 31750751		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36513052	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16437243, 20522597, 23977133, 28211040, 28230773, 28916112, 28978581, 29141886, 29272267, 29513874, 29844327, 30029936, 30284618, 30594747, 31419705, 31750751		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28230773, 29513874, 35691098	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30269996, 30534571, 31949260, 32616532, 33365026, 36657987	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31008114	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34330510	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34429434	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19903740, 20522597, 24816853, 28577136, 28634815, 28869918, 29141886, 29305465, 29995236, 30269996, 30534571, 31199005, 31419705, 31486854		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31008114		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28255845, 28978581, 29141886, 29844327, 30407284		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	27269937, 34102137, 35427471, 35586668	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	28438290, 35238073	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	23193072, 30832606, 30913016		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	21540239, 23674495, 27030389, 27045512, 27564404, 27861596, 28395108, 28403071, 28427522, 28504999, 28685821, 28870600, 29246182, 29247952, 29435074, 29449276, 29748856, 29775689, 29857068, 29946193, 30033844, 30197796, 30209121, 30250823, 30286249, 30384489, 30389217, 30449068, 30458835, 30601579, 30619766, 30666052, 30683910, 30770362, 30861172, 30884772, 30898647, 30910787, 30917792, 30975638, 31007846, 31150165, 31197205, 31269329, 31452749, 31471540, 31493237, 31570691, 31640780, 31679792, 31704289, 31811434, 31844419		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	34207794	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30602320		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	26801886	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	28731046, 29672601		★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	32581063	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	36597662	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	29050367		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	28889921, 31813343		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26181000, 27362548, 27984238, 28347512, 28358435, 28489510, 28752845, 28914717, 29053481, 29061774, 29464025, 29559741, 29572003, 29572029, 29942724, 30247204, 30291344, 30397772, 30401949, 30539847, 30640692, 31069647, 31076855, 31197557, 31319067, 31353229, 31370215, 31651527, 31757677, 31833942, 31846530		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24658839	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28264871, 28347512, 28358435, 28752845, 29053481, 29559741, 30291344, 30401949, 30539847, 30640692, 31370215, 31973911, 32066405, 32376735, 33972391, 34130989, 34158412, 34970268, 35226658, 35242299, 35712817, 35804040, 35880269, 35901358, 36142641, 36207751, 36481790, 36509464, 37106127, 37150803, 37446260, 37797425, 38238314, 39326496, 39794015	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30325236, 30595667		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30325236, 30595667, 33078970, 34656305, 36232911	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	30483834, 31388782		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	31075668		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	32080744, 37084607	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	33637494	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27864219, 30167862, 31600397		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	27565906, 28281549, 28771603, 29850538, 30168897, 30499814, 31681591, 31683962		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	15837746, 27470134, 27838937, 28314315, 28366014, 28693258, 28848143, 29116900, 29206673, 29552135, 29805749, 29859152, 30045299, 30174892, 30275174, 30577521, 31096448, 31134385, 31519770, 31612012		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	15837746, 27470134, 27838937, 28314315, 28366014, 28693258, 28848143, 29206673, 29552135, 29805749, 29859152, 30045299, 30174892, 30275174, 30577521, 31096448, 31134385, 31519770, 31612012		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	15837746		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25337246, 26761210, 27015293, 28848143, 29116900, 31519770, 32500232, 33793074, 34067485, 34693652, 34814273, 34953041, 34973513, 35107757, 35435118, 36130326, 36271484, 36288460, 37108474, 40028339, 40165109, 40587482	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33290281	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26761210, 27120796, 27322149, 27729745, 28039448, 28192623, 28294486, 28404915, 28657901, 28949934, 29060926, 30285868, 30684971, 30975989, 32004580, 32302443, 33054840, 33568088, 33628625, 33725708, 33893689, 34054840, 34297698, 34324661, 34625514, 34773342, 35319779, 35365175, 36288460, 36359828, 36466860, 36568792, 36648946, 36812484, 38032149, 38035081, 38280970, 38619620, 39264227, 40165109	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29866946	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	36266510	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28868758		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	26952546, 34453221, 36159840	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28419539, 28693161, 29732001, 29805739, 30773525		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	29464943		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	34277966	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	27777774		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	39769220	Stimulate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	29308311, 31009388		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	30902819		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	31511925		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	31331053		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29093082		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	31821747		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28093480, 30832606, 31616157		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29882997, 29954840, 30055582, 31272718, 31360065		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30055582, 33328484, 35163489, 36826082, 37094985, 37369470, 37841278	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	23430453, 27281199, 28801853, 29599324, 30931254, 31582185		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20646001	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	28000302		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26801886	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	27777774, 29523759, 32945067, 33180184, 34798858, 35094125, 36996375	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25540867, 30714229, 30762585, 32574962, 34276259, 34804639, 40153818	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	27470968, 28871595, 30714229, 30762585, 31428517		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	27737703, 30054295, 32766875, 33376237, 33889438, 37148546	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	26086854, 29100397		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	27638840, 28423520, 31802108		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	27362903, 28060141		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	39370035, 39632297	Associate	★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	31013360		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28115719, 31379838		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31379838	Inhibit	★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	32377818, 34285260	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20493562, 23613317, 23986257, 26323609, 26501438, 27370400, 28115578, 28178682, 28179106, 28193626, 28404866, 28447277, 28531337, 28652622, 28730140, 28978117, 29016938, 29088776, 29147863, 29399410, 29510196, 29532035, 29632728, 29721184, 29900065, 30011045, 30104292, 30709339, 30777100, 30783513, 30819441, 30916923, 31044422, 31114328, 31302496, 31530559, 31625205, 31661771, 31793634, 31801317		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20493562, 28178682, 28193626, 28531337, 29532035, 30011045, 30709339, 31467175, 31801317, 32080744, 32201424, 32310827, 32401608, 33282092, 33329573, 33496357, 33600097, 33964937, 33987681, 34572014, 34667077, 35165339, 35628503, 35717510, 35814563, 35942769, 36007522, 36580017, 36941554, 36968223, 36980184, 37019647, 37529045, 38057698, 38068712, 40191718	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23613317	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30009488	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17159987, 20493562, 23613317, 23986257, 26266810, 26323609, 26501438, 27370400, 28115578, 28178682, 28179106, 28193626, 28404866, 28447277, 28652622, 28978117, 29016938, 29088776, 29147863, 29399410, 29510196, 29532035, 29632728, 29721184, 29900065, 30011045, 30104292, 30709339, 30777100, 30783513, 30819441, 30916923, 31044422, 31114328, 31302496, 31530559, 31661771, 31793634, 31801317		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14612546, 15973152, 17159987, 23613317, 23986257, 26266810, 27370400, 28388955, 28490949, 28591697, 28652622, 28721584, 28919992, 28978117, 29396299, 29784449, 29900065, 30333036, 30687086, 30824583, 31152305, 31213836, 31397999, 31610656, 31661771, 31712430, 31793634, 31850228		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15973152		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23613317	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26771840, 27370400, 28475775, 28531337, 28591697, 28620836, 29254497, 29396294, 29396299, 31152305, 31819973, 32424065, 32457124, 33224142, 33282092, 33329573, 33600097, 33815356, 33963441, 34114970, 34118979, 34507430, 35265072, 35481923, 35720326, 35723030, 36199422, 36309750, 37275863, 37330579, 37837543, 40214367, 40696074	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	34162346, 34876047	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28770269		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28770269, 33121190	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	39696012	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36701715	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIB	Glycogen storage disease	Pubtator	27103510	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	34603331	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31393854	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33598108, 34432868, 36898735	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28414296, 28414300, 28953925, 29212909, 30574431, 30622541, 30725359		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	18322304, 19850680, 31182340		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	34074094, 35619700	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35619700	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27825291, 28974264, 29128181, 30121940, 31182340, 31656199		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32348468	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32750756, 34021249, 34074094, 35238073, 36093111, 38457034	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28480996, 28511705, 28604812, 28721019, 28811971, 28932643, 29434933, 29946185, 30002656, 30219915, 30282672, 30547012, 30565869, 30668545, 30854100, 31317017, 31436392, 31848196		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26676749, 26918453, 27841362, 28476872, 29212506, 29362132, 30219915, 30282672, 30565869, 32699939, 33138288, 35140722, 35834946, 37094985, 38200037, 39939997	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34103354	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29212909		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28197370, 28716069, 29158788, 29623256		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	28832074, 30801864, 32294103, 35365586	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	32222780	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28062906, 28807048, 28935250, 29360721, 29378725, 29428449, 29775689, 30464684, 30505301, 30915922, 30917792, 31086024, 31185600, 31186046, 31808941		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32366559, 35081690, 39769169	Associate	★☆☆☆☆ Found in Text Mining only
HEMIHYPERPLASIA, ISOLATED	Hemihyperplasia	BEFREE	31019947		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	35173033	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	34938356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21876620, 24842267, 31610173, 34478821, 35746817	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31367249	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	34478821	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29057919, 36916425, 37768345	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32313717	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary clear cell renal cell carcinoma	Hereditary Renal Carcinoma	BEFREE	30522901		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	27984238, 29327160, 31444293		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	29750666, 31190978		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Motor Neuropathy	Hereditary sensory and motor neuropathy	Pubtator	36884083	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	33500467	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis	Histiocytosis	BEFREE	26110571		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18203952		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19703193, 22271878, 25482239, 27069084, 27158757, 27737878, 27861596, 28893733, 29394125, 29449276, 29880615, 29902298, 30261066, 30282880, 30564891, 30783096, 31395597, 31697809, 32143684, 33184699, 33558066, 33620088, 33782477, 34424037, 34477818, 34511545, 34842351, 34980000, 35060170, 35833296, 36032657, 36083129, 36326378, 36894899, 36990776, 37369476, 37642071, 38175373, 40030000	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21540239, 22271878, 26049755, 27045512, 28497159, 28514441, 28683452, 28893733, 29255458, 29380399, 29435074, 29449276, 29521140, 29698935, 29775689, 30384489, 30458835, 30564891, 30637917, 31205470, 31456438, 31471540, 31699300		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	30910787	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	30339966		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30770752		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	23056446, 36911725	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	32030476	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	32703503, 33414372, 36263036	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30594747, 31733200		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	29739808		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	29971696		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	29036261, 29371688		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29889673, 29971696, 30861560, 31813343		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	29693186, 34118979, 34254261, 34367731, 34819027, 35499071, 36445478, 36494419, 37067635, 40429910	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32255193, 32466213, 32521117, 32802199, 34250747, 34363337, 34484235, 34789838, 35945448, 37240068	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	28405501, 28463396, 29900051, 31555701		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30746211, 30763282		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33386384, 37121574	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24376655, 30659749, 33837055, 34597347, 34706885, 37858677	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	26140546, 28062906, 29345058, 30341238, 30659749, 30872155		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29333980, 30808044, 31651870		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24673799, 28710273, 29337305, 29438316, 29987244, 30459153, 31253167, 31253857		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30692527		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	18791172		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15131796		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29910803, 30600673		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30864556, 35848481	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	25940795, 27196778, 28373294, 28422766, 29425258, 29858752, 30777104		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	16085391, 29138509		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	29163763, 29449680		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	29277923		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	34497449	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	27226337, 28076847, 31152546	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	35427471	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28236118, 28438290, 31190978		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28445951, 30323667, 30419854, 30646854, 30885276, 31367249, 31383016, 31410753		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28894845, 29516978, 30085937		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29609005		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23674495, 28919987, 29018115, 31743287		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21540239, 24404580, 29122656, 30093402, 31125630, 31151983, 31383967, 31809310		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	36275893	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28152514, 35194801	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	28954788, 30996253		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17340590, 30996253, 31672701, 35173532, 35184226, 35240013, 39301023	Associate	★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	30765258		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	23632869, 30361911, 34356594, 37462760	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26408403, 29257349, 29271789, 30361911		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	29308311		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	37348508	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28405501, 29308311, 30112112, 31009388		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	28440953, 28832074, 32294103, 35349638	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	29312289		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	36142557	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16797416, 18756622, 20814675, 23300177, 27708227, 29378725, 31185600, 31705171, 32268011, 35795681, 36960055, 37193972, 37554265	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18756622		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21768400, 24336068, 26140546, 27543594, 27907031, 28916658, 29378725, 31185600		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	35476232	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	23175469	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18756622, 20814675, 29449224, 30500073, 31185600, 31291985, 32245463, 33284559, 34171128, 34432868, 35558161, 35794161, 37166484, 37193972, 37431262, 37777506, 38085150, 38615511, 39369651, 40225861	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	24270737	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15536145, 24270737, 25499621, 26712908, 27543594, 28321813, 28555079, 28643044, 29206680, 30204524, 30500073, 30675316, 30911134, 31185600, 31406210		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	24270737		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	31500267		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	30978501		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	30361911		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	30160018, 31027907		★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Lichenoid Eruptions	BEFREE	27859479		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	29308311		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30160018, 30466788		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	28688724		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	25392179, 28405501, 28688724		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	28832074, 30400799, 32294103, 34237209, 34276259, 35204793, 35349638, 36683495	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	28832074	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	30400799		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19451266, 19826049, 20473887, 20840059, 21853301, 22005063, 26084609, 26367730, 26581194, 27456947, 27913861, 28005469, 28147363, 28254435, 28276530, 28339084, 28344887, 28363643, 28465485, 28471952, 28493410, 28558264, 28624577, 28627705, 28928158, 28939663, 29028787, 29090321, 29113661, 29144460, 29258079, 29400599, 29413757, 29525632, 29525633, 29556041, 29593314, 29620156, 29683262, 29705790, 29921949, 29940148, 29940275, 30007230, 30057891, 30078052, 30254644, 30267213, 30327605, 30387047, 30506460, 30538492, 30539869, 30555574, 30626493, 30711629, 30715244, 30718977, 30723578, 30800658, 30810243, 30854665, 30902885, 30922248, 30930222, 30969136, 30978501, 30996212, 31061454, 31071366, 31076403, 31161238, 31186768, 31231126, 31258764, 31295151, 31304819, 31337865, 31379842, 31423211, 31425839, 31437792, 31538897, 31539182, 31551142, 31572677, 31615069, 31678303, 31724091, 31727135, 31760568, 31767125, 31811905, 31815045		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	22396772		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20473887, 21615390, 30254644		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	29093082, 34478821, 36265835	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39252214	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19739236, 34478821, 37308878, 38268921	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26367730, 35615575	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20473887, 28788102, 30693544, 31161238, 31727135		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	18684942		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28387300, 28925087, 32557663, 32591432, 32787374, 33239417, 35398240, 36426899, 37305382	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32389949, 32648466, 33185333, 33218332, 37535195	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29844002, 31030326, 31793661		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15297412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	20514052, 23460533, 25073001, 26014096, 26361045, 26657115, 26667490, 26756646, 26762740, 27393506, 27440266, 27467256, 27502709, 27610620, 27834350, 27846317, 27913228, 28059094, 28104537, 28289860, 28446544, 28577937, 28878242, 28881488, 28884747, 28980429, 29049375, 29053224, 29108454, 29110262, 29212506, 29246835, 29374053, 29659668, 29667757, 29800747, 29946185, 30019892, 30275099, 30282880, 30305853, 30318514, 30521597, 30653748, 30842489, 30973703, 30986912, 31005568, 31014354, 31086949, 31132649, 31145232, 31196152, 31209979, 31294893, 31420048, 31480591, 31481045, 31489465, 31527554, 31550464, 31561631, 31625289, 31659278, 31678168, 31740722, 31821665, 31923366, 31999935, 32017467, 32067413, 32297484, 32303234, 32426898, 32587640, 32703503, 32721105, 32755111, 32893980, 33044045, 33181636, 33413365, 33414372, 33471184, 33479024, 33486901, 33506299, 33650770, 33818637, 33915250, 33956842, 34020945, 34038737, 34140315, 34240739, 34253166, 34321489, 34324065, 34475187, 34558414, 34572136, 34610219, 34681614, 34685495, 34887263, 34963470, 35250988, 35254478, 35273829, 35373505, 35402080, 35464416, 35514075, 35545838, 35586668, 35596539, 35708777, 35743122, 35844508, 35858707, 35963646, 35981786, 35984185, 36100844, 36117149, 36291098, 36436331, 36520426, 36561745, 36575294, 36593005, 36723380, 36800626, 36856921, 36915197, 37092578, 37274772, 37301135, 37340370, 37378912, 37455369, 37843335, 37930659, 37964220, 38177076, 38219464, 38238740, 38625026, 38626874, 39201772, 39382248, 39413743, 39908681, 40381506	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	24078774, 26419961, 28819064, 28878242, 29196495, 29510739, 30126206, 30318514, 30766753, 30771521, 31086949, 31235866, 31331645		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27692344		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	28925087, 31552680	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	32468028	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22389764, 30919595		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	35979531	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	35979531	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18650228	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19759858, 22389764, 24288552, 35979531, 38233074	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26867643, 33198645, 33777025	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	22389764, 30919595		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19116915, 19395451, 22389764, 29069649, 30396745, 30502542, 30919595		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28631301, 29069649		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	34081342	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	22389764, 30919595		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	30095976		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24124529, 25733810, 27120796, 27217541, 27591097, 27741514, 28030840, 29291717, 29378617, 29395669, 29516978, 29942303, 30361911, 30539847, 30568128, 30874607, 31275983, 31492714, 31683723, 31844270, 32884946, 33062072, 33299660, 33740124, 33909149, 34054869, 34325991, 34953041, 36088412, 36309362, 36359828, 36518249, 36587234, 37071062, 37455369, 37501393, 37660535, 37970475, 39356010, 40246986, 40587482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25609202, 28230773, 28522811, 29073638, 30539869, 32389639, 32750756, 33158004, 35845949	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28076847	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28693161, 29742559, 30361911, 31633227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	36969238	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21540239, 22462616, 26049755, 26248256, 27045512, 27564404, 27861596, 28218497, 28349165, 28685821, 29084057, 29122656, 29128997, 29297942, 29380399, 29514845, 29695766, 29850620, 30132131, 30458835, 30867773, 30925928, 30938862, 31185600, 31382969, 31503548, 31570691, 31704289		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	26702065, 26850007, 27527850, 27564404, 27861596, 28496056, 29998979, 30146572, 30683910, 30723112, 30938862, 31150165, 31184237, 32054467, 32248797, 32335702, 33876323, 35081690, 37809067, 39712032	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	CTD_human_DG	28736328		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Follicular	Lymphoma	Pubtator	23674495, 35734168	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29368155, 29761078, 30683910, 30705877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	30327655, 30867773		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	30659053, 31253857		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28402953, 30025443, 30197796, 30214445, 30659053, 31253857		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28402953, 30214445, 30659053, 31253857		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29895574		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28826073		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	19597183, 22271878, 23674495, 30033844, 30683910, 31269329, 34842351	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	22271878, 29018115, 29084057, 29380399, 30861172		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	27984238, 29327160, 31444293		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	28463396, 29308306		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	14612546, 29730815		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28480996, 28511705, 28604812, 28721019, 28811971, 28932643, 29434933, 29946185, 30002656, 30219915, 30282672, 30547012, 30565869, 30668545, 30854100, 31317017, 31436392, 31848196		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	25609200, 30546952, 31536478		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	27544053, 28922567, 29147606, 29773326, 30794891, 31363159, 31545419		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	27544053, 28619621, 30794891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20626886, 23828443, 24551119, 24647569, 24842267, 25669979, 25940795, 26245467, 26554829, 27138387, 27146558, 27221508, 27422273, 27468881, 27531819, 27589570, 27870715, 27925176, 27935862, 28058578, 28079291, 28160557, 28167507, 28187748, 28195880, 28197375, 28230773, 28346916, 28404866, 28430626, 28453554, 28572258, 28614911, 28651116, 28697066, 28721684, 28731046, 28739716, 28784153, 28799073, 28843709, 28881675, 28894845, 28916815, 28936553, 29041905, 29061774, 29104508, 29118259, 29163490, 29163540, 29168430, 29198959, 29245948, 29282694, 29438316, 29516978, 29524062, 29588392, 29615063, 29675979, 29695766, 29702007, 29789418, 29802358, 29890396, 29914097, 29929548, 29936058, 29961778, 29983831, 30064200, 30085937, 30241942, 30393583, 30443687, 30498230, 30524905, 30547271, 30594747, 30607162, 30624770, 30627961, 30633926, 30765258, 30781490, 30803931, 30842061, 30866717, 30892954, 30901292, 30902796, 30904483, 30906504, 30915120, 31008945, 31022191, 31060337, 31061067, 31075727, 31081058, 31096176, 31152305, 31165561, 31217296, 31227501, 31336685, 31398408, 31409638, 31428520, 31444294, 31455411, 31473251, 31516390, 31521537, 31581535, 31584964, 31599562, 31614877, 31641154, 31646095, 31665051, 31702880, 31721331, 31819174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26181000, 27362548, 28358435, 28489510, 29464025, 29572029, 29942724, 30247204, 31076855, 31319067, 31833942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15837746, 27470134, 27838937, 28314315, 28366014, 28693258, 28848143, 29206673, 29552135, 29805749, 29859152, 30045299, 30174892, 30275174, 30577521, 30822683, 31082908, 31096448, 31134385, 31519770, 31612012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29882997, 29954840, 30055582, 31360065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	26871284, 27777774, 28615369, 29523759, 29700411, 30161295, 30827742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	24504486, 27426025, 27491898, 27801735, 28815334, 29360724, 29983240, 30134343, 30405053, 31155004, 31672701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	30361911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30161295, 30711629, 30715244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25862146, 25963805, 26014096, 26420858, 26473645, 26637667, 26756646, 26762740, 26883990, 26901614, 26944305, 27393506, 27393509, 27438512, 27502709, 27610620, 27801735, 27834350, 27846317, 27913228, 28024695, 28059094, 28104537, 28111119, 28114251, 28152514, 28213003, 28213726, 28288993, 28302866, 28385373, 28446544, 28484456, 28492290, 28577937, 28604752, 28664936, 28675453, 28679395, 28679765, 28684311, 28700789, 28714780, 28748356, 28795532, 28835513, 28849209, 28851100, 28860576, 28884747, 28925087, 28932563, 28980429, 29029512, 29031195, 29049375, 29053224, 29069824, 29088766, 29119113, 29119407, 29137398, 29152077, 29175115, 29187498, 29194117, 29212506, 29246835, 29254651, 29296193, 29306075, 29309540, 29360723, 29374053, 29423109, 29426340, 29435109, 29467274, 29476608, 29507487, 29510096, 29516506, 29526752, 29568386, 29659668, 29666465, 29667757, 29675791, 29683890, 29703650, 29726585, 29736798, 29779430, 29871672, 29898990, 29937998, 29938855, 29945961, 29946185, 29948020, 29997286, 30006825, 30019319, 30019892, 30059678, 30061230, 30075155, 30125216, 30134343, 30215300, 30253080, 30262399, 30275099, 30282880, 30297358, 30305853, 30367104, 30397852, 30416860, 30425525, 30429043, 30446226, 30482633, 30514666, 30521597, 30564891, 30591531, 30616523, 30653748, 30746209, 30755403, 30760579, 30771521, 30778885, 30790069, 30815801, 30819828, 30842489, 30850589, 30860657, 30914312, 30932979, 30948928, 30958600, 30972999, 30986912, 30995715, 31002007, 31003463, 31005568, 31019805, 31021072, 31031765, 31050216, 31079031, 31145232, 31178388, 31196152, 31209979, 31294893, 31331645, 31348245, 31399559, 31404614, 31420048, 31435660, 31462002, 31480591, 31498156, 31513911, 31550464, 31555517, 31561203, 31561631, 31612048, 31625289, 31675543, 31686247, 31722999, 31740722, 31741753, 31747941, 31760310, 31801624, 31809311, 31821665		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27692344		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21723642, 30466788		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	28351581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	29113315, 31010620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23340297, 24297569, 25081699, 25998800, 26541760, 26573793, 26625204, 27626654, 27671674, 27986748, 28065619, 28266500, 28344892, 29055949, 29171115, 29171986, 29337305, 29485423, 29496294, 30045136, 30078505, 30207101, 30412078, 30522700, 30582756, 30702189, 31039792, 31311810, 31432577, 31492714, 31533774, 31611650, 31695427, 31781843, 31799599, 31821542, 31851060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24378899, 25795132, 26423423, 27402485, 27589570, 27797936, 28030840, 28112370, 28131992, 28442920, 28527946, 28769571, 28826722, 29081663, 29100036, 29385739, 29576277, 29599908, 29999557, 30214445, 30254451, 30301530, 30377341, 30653106, 30670333, 30709380, 30886310, 30927618, 30991694, 31032528, 31069140, 31101760, 31179334, 31206665, 31284422, 31291716, 31423221, 31440238, 31608800, 31818309, 31837335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of penis	Penile cancer	BEFREE	27697578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18850006, 20971039, 26260996, 26573597, 27363678, 27462860, 27835597, 28223102, 28461179, 28797844, 28893901, 29125731, 29160310, 29360724, 29392925, 29535806, 29577933, 29582792, 29641940, 29679564, 30257853, 30321406, 30537104, 30541755, 30610805, 30709785, 30733677, 30827759, 30890551, 30984182, 31035590, 31182913, 31261165, 31289580, 31545446, 31567999, 31641355, 31653272, 31680565, 31697036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	29409471		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29721394, 30993371		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22190470, 23430453, 24657498, 25733810, 27147580, 27260946, 27465786, 27629881, 27889799, 27934877, 28056089, 28076847, 28222426, 28274999, 28412752, 28507801, 28671728, 28754154, 28775777, 28794626, 28796808, 28910818, 28938605, 28969052, 28978018, 29034543, 29073638, 29245908, 29259270, 29345842, 29399387, 29534305, 29542354, 29614789, 29673110, 29690901, 29727332, 29872566, 30003113, 30120163, 30145830, 30206229, 30221053, 30239046, 30264329, 30353572, 30419350, 30463584, 30537988, 30552042, 30565045, 30587982, 30664822, 30670970, 30729066, 30842953, 30874607, 30881447, 30925913, 31043675, 31060469, 31087180, 31110545, 31152268, 31285589, 31290727, 31322226, 31372044, 31451991, 31452748, 31463730, 31471921, 31519868, 31557409, 31595457, 31620857, 31669518, 31704366, 31722674, 31848322		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	29928359		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thymus	Malignant Neoplasm Of Thymus	CTD_human_DG	28736328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26943572, 28093480, 29455638, 29731981, 30762153, 30897754, 30913016, 31252406, 31821747		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30588196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25730066, 25963805, 27460757, 27816403, 27987237, 28096371, 28214651, 28357911, 28393361, 28493171, 28500617, 28579805, 28599483, 28675174, 28978000, 29133939, 29271413, 29325739, 29472240, 29553950, 29562804, 29599921, 29844686, 29855698, 29941343, 29969606, 29983890, 30003574, 30209552, 30275703, 30315148, 30344922, 30400941, 30425515, 30446009, 30463956, 30548363, 30552042, 30594037, 30606990, 30627815, 30791940, 30871066, 31011905, 31102277, 31117036, 31159302, 31190987, 31201825, 31267201, 31341011, 31385407, 31534011, 31570249, 31616289		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14686489, 16455204, 17159987, 17186290, 20601920, 20626886, 21159661, 21540239, 22005063, 22190470, 22204817, 22828443, 23430453, 23674495, 23785454, 24029602, 24297569, 24336068, 24416729, 24468585, 24647569, 24657498, 24673799, 24714771, 24764583, 25392179, 25428505, 25645920, 25682184, 25695955, 25733810, 25963805, 26014098, 26141060, 26305724, 26323609, 26408403, 26564005, 26678880, 26681673, 26779629, 26871470, 26918453, 26960397, 27061215, 27106868, 27166394, 27198569, 27221508, 27225694, 27281199, 27362548, 27393509, 27422273, 27470134, 27491050, 27522179, 27581532, 27620277, 27639678, 27671167, 27671674, 27683114, 27688163, 27696202, 27720718, 27737703, 27777774, 27788043, 27801734, 27806346, 27816403, 27825291, 27827313, 27835597, 27846317, 27889799, 27903500, 27911273, 27913861, 27919908, 27934877, 27960080, 27981577, 27984238, 28000537, 28030840, 28033249, 28039448, 28059093, 28069723, 28073774, 28075442, 28076847, 28079291, 28086852, 28093480, 28096371, 28107571, 28132417, 28160557, 28163164, 28167507, 28169111, 28183254, 28193626, 28195880, 28213726, 28217128, 28218497, 28220772, 28223273, 28235763, 28239469, 28247187, 28255845, 28256540, 28258692, 28258703, 28270499, 28281549, 28288993, 28289089, 28302866, 28334399, 28335643, 28335888, 28345650, 28347512, 28353093, 28358435, 28367063, 28377497, 28389693, 28402953, 28404915, 28409437, 28418281, 28421161, 28423520, 28424330, 28427522, 28428193, 28445951, 28446641, 28453554, 28460462, 28466543, 28467889, 28468947, 28476872, 28483787, 28484456, 28492290, 28495553, 28497159, 28499515, 28507803, 28511092, 28511795, 28512174, 28514441, 28514966, 28522738, 28522811, 28524003, 28539467, 28549039, 28564605, 28576522, 28608950, 28611299, 28614911, 28622889, 28642997, 28650338, 28653677, 28657901, 28677815, 28679765, 28679835, 28681030, 28684274, 28685821, 28694003, 28710313, 28711324, 28716069, 28721097, 28752839, 28756224, 28769571, 28778959, 28784153, 28796808, 28811252, 28811961, 28813417, 28826073, 28827658, 28832979, 28842748, 28843649, 28846888, 28848143, 28849209, 28864496, 28864844, 28878676, 28881780, 28889921, 28893901, 28901258, 28901560, 28903377, 28916815, 28928158, 28929192, 28938692, 28942432, 28947422, 28954788, 28978000, 28982322, 28987965, 28993412, 29018057, 29046141, 29055949, 29066622, 29069824, 29079455, 29081663, 29081778, 29093678, 29097421, 29097600, 29100036, 29103968, 29113661, 29114543, 29119407, 29123963, 29125905, 29147602, 29147606, 29158788, 29160310, 29163797, 29163822, 29170499, 29174371, 29175457, 29178534, 29190964, 29212506, 29217732, 29227818, 29228642, 29228840, 29230210, 29233903, 29241377, 29246442, 29250474, 29251665, 29255458, 29256113, 29260623, 29262340, 29282694, 29283446, 29296096, 29299180, 29308309, 29308318, 29319049, 29327160, 29328389, 29337305, 29339539, 29344157, 29348848, 29351920, 29356178, 29357948, 29358503, 29360724, 29360727, 29360728, 29362132, 29363363, 29365144, 29370105, 29374053, 29374054, 29374744, 29378694, 29385739, 29403308, 29408916, 29409471, 29412659, 29416641, 29419471, 29423109, 29423114, 29426340, 29435162, 29436178, 29440147, 29459478, 29467945, 29471699, 29473504, 29480817, 29489427, 29510196, 29510739, 29518754, 29526974, 29531322, 29532035, 29535832, 29552135, 29556232, 29562194, 29562816, 29601633, 29602174, 29618381, 29626502, 29632719, 29633300, 29641940, 29651624, 29658430, 29661225, 29661720, 29668679, 29674442, 29679564, 29685882, 29695766, 29702007, 29707344, 29728568, 29742559, 29746929, 29748390, 29750666, 29762141, 29765039, 29765155, 29767245, 29769148, 29773717, 29776963, 29779430, 29789418, 29843803, 29843813, 29848031, 29850538, 29855617, 29857011, 29859006, 29859152, 29871672, 29872177, 29872559, 29872574, 29872575, 29874226, 29876769, 29880231, 29884866, 29890396, 29898990, 29900065, 29902298, 29923984, 29951302, 29951309, 29951336, 29952768, 29954240, 29959712, 29961183, 29967259, 29970158, 29971465, 29973653, 29991874, 29996738, 30002656, 30012633, 30012853, 30025829, 30026851, 30034316, 30035369, 30037229, 30040142, 30059678, 30061230, 30061887, 30063587, 30077123, 30085020, 30101407, 30112112, 30120041, 30120163, 30122958, 30123214, 30123362, 30128738, 30133286, 30137232, 30153998, 30160018, 30161295, 30178256, 30181171, 30183502, 30185888, 30191996, 30193240, 30194181, 30195467, 30198904, 30201790, 30209552, 30215856, 30221065, 30222314, 30228206, 30230653, 30232146, 30242316, 30242549, 30247903, 30250823, 30253680, 30267842, 30268773, 30269996, 30275099, 30275987, 30279188, 30283733, 30287140, 30294272, 30301530, 30312607, 30323667, 30325236, 30326786, 30333036, 30341017, 30344919, 30344922, 30352860, 30356816, 30370857, 30373602, 30374610, 30385408, 30387832, 30389217, 30389797, 30396996, 30399174, 30400941, 30413322, 30413824, 30417781, 30418532, 30425139, 30425517, 30426611, 30442814, 30446226, 30459153, 30463956, 30466788, 30476528, 30478423, 30497521, 30498900, 30511201, 30515672, 30518694, 30519541, 30521597, 30521746, 30522901, 30523370, 30527665, 30528137, 30537988, 30539796, 30546955, 30546958, 30552042, 30552160, 30564890, 30564891, 30574211, 30579259, 30580966, 30582756, 30604042, 30622541, 30624770, 30627987, 30631935, 30646794, 30649742, 30651147, 30667073, 30670333, 30675316, 30682108, 30705400, 30709339, 30709380, 30717797, 30719168, 30723299, 30755167, 30755733, 30760860, 30769852, 30770752, 30771277, 30772141, 30773525, 30781490, 30784027, 30784085, 30786013, 30787326, 30797490, 30814731, 30816886, 30819829, 30822683, 30833000, 30833750, 30854100, 30860657, 30861560, 30864729, 30867826, 30873585, 30878596, 30878834, 30888929, 30895168, 30895946, 30899426, 30915036, 30931254, 30932979, 30938862, 30941125, 30941308, 30949408, 30952714, 30958600, 30963235, 30977778, 30982497, 30990738, 30991694, 31005030, 31008945, 31014381, 31021376, 31022191, 31022941, 31027450, 31030093, 31030234, 31035644, 31040694, 31043352, 31044422, 31047727, 31053471, 31063806, 31069878, 31074879, 31076547, 31079031, 31088979, 31096532, 31098772, 31102277, 31125352, 31128036, 31128201, 31137683, 31146499, 31150782, 31151293, 31159869, 31164357, 31164885, 31179334, 31182340, 31185600, 31186768, 31191745, 31196138, 31197205, 31201647, 31202914, 31208922, 31212653, 31216214, 31222938, 31234464, 31250752, 31252398, 31253869, 31265222, 31270456, 31270941, 31274701, 31277179, 31294893, 31299636, 31302192, 31305264, 31316145, 31325788, 31335407, 31342270, 31343834, 31348579, 31351692, 31353229, 31359805, 31367249, 31372044, 31383402, 31384666, 31387102, 31391510, 31399419, 31399559, 31405171, 31407173, 31410753, 31422157, 31423221, 31423245, 31428520, 31436822, 31444293, 31462002, 31488176, 31502147, 31507611, 31511071, 31513320, 31523194, 31535847, 31541031, 31542865, 31546072, 31546897, 31546905, 31549270, 31555284, 31586491, 31611702, 31612217, 31632907, 31635909, 31636634, 31639551, 31646108, 31653140, 31668929, 31672625, 31681269, 31683962, 31686860, 31696332, 31699145, 31704149, 31707719, 31720083, 31720814, 31721643, 31722999, 31723167, 31727249, 31727344, 31748880, 31751121, 31760568, 31761384, 31764833, 31771762, 31777260, 31788476, 31805690, 31813343, 31818309, 31819612, 31821747, 31825827, 31828774, 31839609, 31846530		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28991373		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	26408403, 30972492, 31010620, 31429521		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	29928359		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27721577, 27754760, 28059093, 28833798, 28870938, 28912897, 29095678, 29104629, 29403308, 29706653, 29855617, 30123362, 30397772, 30755279, 30774597, 30826965, 30943124, 31143091, 31274701, 31331818, 31348579, 31808707		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27196573, 28107571, 28223102, 28406723, 28940664, 29102042, 29742733, 29872559, 30206410, 30228206, 30389315, 30755167, 30873025, 31105882, 31322270, 31354723, 31406255, 31412307, 31570897, 31651174, 31744296, 31812723		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17920123, 18294387, 18572307		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24647569, 24764583, 26245467, 28881675, 29339440, 29672601, 29757193, 30524905, 30547271, 30894361, 31234464, 31248966, 31320901, 31591439, 31756919		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28626618, 30821551		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	27465786, 28347512, 29523759, 31429779, 31524634		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23267208, 29378725, 31086024		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	29378725	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Mastocytosis	Pubtator	29378725	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	29378725	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	29378725		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	20628145, 29189264, 29377256, 31040936, 31150165		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26965581, 28821192, 31152546		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26965581, 30528043, 31152546		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27463676, 28474991, 29399402, 29721192		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	34795058	Associate	★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	BEFREE	29185395		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18296654, 20948441, 23095323, 23307859, 24029602, 24054424, 24416729, 24647569, 24812408, 25223485, 25370533, 25844720, 25895097, 25944800, 25963805, 26086854, 26176707, 26359984, 26501438, 26775640, 26871470, 26960397, 27106868, 27160390, 27628745, 27671167, 27671674, 27759577, 27801734, 27846054, 27868139, 27991907, 28079159, 28114251, 28199980, 28213726, 28223273, 28231855, 28301259, 28302645, 28325255, 28368722, 28393361, 28427522, 28428193, 28452169, 28471952, 28512174, 28514441, 28522460, 28530662, 28546465, 28616701, 28680759, 28693793, 28694003, 28716069, 28724663, 28728868, 28737763, 28740692, 28778959, 28803721, 28807048, 28811971, 28820000, 28827658, 28833504, 28835386, 28861116, 28912897, 28914674, 28938692, 28984690, 28985469, 29100397, 29118259, 29156488, 29185395, 29187493, 29189265, 29230210, 29238207, 29250474, 29250533, 29255458, 29320474, 29337305, 29382670, 29425258, 29492229, 29505109, 29509748, 29602773, 29607663, 29633300, 29644214, 29650750, 29660160, 29750751, 29760800, 29769148, 29786078, 29872559, 29872580, 29942309, 29946185, 29967259, 30002656, 30021673, 30042403, 30063587, 30120967, 30137232, 30150374, 30178256, 30209062, 30221051, 30244524, 30291344, 30343006, 30343532, 30357969, 30373548, 30373602, 30374200, 30464501, 30487198, 30524879, 30538110, 30546949, 30635795, 30735560, 30737234, 30742405, 30873585, 30940644, 30940655, 30941125, 31031765, 31060225, 31063806, 31069878, 31079031, 31113840, 31128201, 31128215, 31171876, 31190995, 31221619, 31234464, 31281485, 31317017, 31335487, 31375512, 31383965, 31417907, 31484550, 31506076, 31517642, 31557787, 31584451, 31607917, 31612048, 31625630, 31639786, 31741714, 31741766, 31744296, 31785018, 31806779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	19651643, 20143437, 20948441, 21346771, 21547596, 22461641, 22850568, 24130734, 24226422, 24639349, 24714771, 24778320, 24812408, 25223485, 25370533, 25736262, 25788491, 25844720, 25944800, 26037795, 26176707, 26419843, 26562159, 27671167, 27837027, 27863197, 28026870, 28084337, 28199980, 28223273, 28231855, 28331615, 28428193, 28434031, 28476944, 28494868, 28546465, 28737763, 28912897, 29057919, 29174371, 29189265, 29212506, 29331888, 29505109, 29509748, 29538091, 29946185, 29973670, 30021908, 30042403, 30096704, 30343532, 30678715, 30735560, 31069878, 31506076, 31514305, 31625630, 32043781, 32120023, 32162809, 32210221, 32586358, 32761808, 32799717, 32815748, 32969795, 33266349, 33288749, 33344042, 33589521, 33793576, 34049578, 34112666, 34130989, 34179721, 34321489, 34367731, 34389558, 34437586, 34503964, 34572136, 34688409, 34763479, 34795662, 34843679, 35087523, 35094125, 35552752, 35793874, 35802807, 35935946, 36016960, 36045683, 36113897, 36131912, 36248850, 36780608, 36923309, 37096557, 37217516, 37229906, 37298135, 37318520, 37507765, 37614091, 37678920, 37865395, 37872588, 37898793, 37923822, 38171116, 38243078, 38484692, 38511744, 38583742, 39209782, 39237877, 40023845, 40222200, 40305358	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	29320474, 30880120, 33669410	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	28737763, 29185395, 30236595, 32495158, 32969795, 33262254, 34130989, 35116193, 36466837	Associate	★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	31730010		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25609200, 29427150, 30153998, 30379704, 31030234, 31536478		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25609200	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	27624915, 31030234, 32839486, 35289329, 36538194, 39295608	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30715244, 31009821		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	24416729, 26627015, 27984768, 28373005, 28438774, 28569410, 28976209, 29033592, 29123950, 29172995, 29217527, 29217732, 29219612, 29220526, 29478343, 29560342, 29566106, 29616562, 29721394, 29744662, 29933728, 30004857, 30073632, 30238195, 30285852, 30287935, 30694842, 30733932, 30747264, 30784027, 30976104, 30993371, 31024834, 31060469, 31142383, 31164102, 31277904, 31343994, 31488176, 31786889, 31808008		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24926549, 31537897, 36754859, 36901697	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	27544053, 28629895, 28811252, 28922567, 29105302, 29163783, 29233904, 29473471, 29669604, 30605211, 31046484, 31363159, 31537897		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24926549, 25774992, 27544053, 28257959, 28629895, 28811252, 29079455, 29575535, 29946373, 31866087, 32438515, 32929059, 33100328, 33493383, 34261675, 34294087, 34655161, 34987640, 36115921, 36172747, 36754859, 36897589, 37002247	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22461641, 24639349, 25079100, 25207460, 25223485, 26037795, 26631501, 28058658, 28199980, 28301259, 28331615, 28412591, 28489616, 28537004, 28574977, 28616701, 29195116, 29373180, 29961183, 29983240, 30021908, 30120967, 30157785, 30320114, 30681807, 30713799, 30735560, 30777131, 30931305, 30996010, 31056729, 31171876, 31335487, 31625630, 31731818, 31803366		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29577933, 29641940		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	31640402		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26261529, 31656199		★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	28522811, 31841221		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	31777260		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	29730815		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	17363736		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31142513	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	32546692	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32041789, 32255193, 34500779, 36231010, 36597662, 37175900, 39595926	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	29323731, 31152546		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	28711734, 30418532		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	36947997	Associate	★☆☆☆☆ Found in Text Mining only
mucosal melanoma	Mucosal Melanoma	BEFREE	30373548		★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	31182340		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17363736, 22828443, 27440711, 27688163, 27919908, 28199990, 28456791, 28461396, 28642819, 28685821, 28875836, 29404682, 29493401, 29580288, 30147691, 30327655, 30505301, 30538704, 31125526, 31245191, 31462737, 31620907		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17363736, 20460501, 21248470, 21577144, 25979485, 26444869, 26468228, 27418644, 28461396, 31462737, 31991058, 32024967, 32079038, 32724129, 33457074, 33488620, 33735518, 35371618, 35593325, 36338146, 36355079, 36359760, 37844355, 39769169, 39891948	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15342209, 21360758, 22067141, 29163808, 30847367		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21360758, 30847367, 38422689	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	22067141	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	30278997, 30682845, 31374257, 31462152, 31681591		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	29132694, 35194801, 35373781	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20472834, 24270737, 25608238, 27686004, 28643044, 28760297, 29378725, 30675316, 30737486, 31406210, 31611955, 31705171		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20472834, 24270737, 25608238, 31705171, 36810783	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19420358, 28484463		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29378725, 29467301, 30132131, 30851544		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29847991, 30642547, 30762312		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	LHGDN	17938288, 18684942		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30721928, 31085720, 31534205, 31707280		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	37827123, 39333574	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	31838162		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	12923066		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	31635909, 31838162		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	16437243		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	28314785		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	20515572, 36804777	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30519393		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	27696202, 29966370, 30935402		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23674495, 25361008, 27341634, 27807760, 28256540, 29584545, 31138162, 31664962, 31722750, 32199452, 32564263, 32679194, 33380650, 33402600, 34933967, 35365045, 35729260, 36189291, 36233023, 37828560, 38015220	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27341634, 28256540, 28351581, 28638740, 28688685, 28837405, 28881642, 29180882, 29547766, 29672367, 29756253, 29988031, 30304846, 30582240, 30668545, 30863173, 30912808, 30982497, 31138162, 31139018, 31295651, 31664962, 31709181, 31850219		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	32191754	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	28453692, 34453221	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	30409778, 31300273		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29789013, 35380716, 36734432	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14559843, 14612546, 15973152, 16606666, 17159987, 17186290, 18296654, 18347814, 18608206, 18841514, 19430887, 19451266, 20473887, 20601920, 21577144, 21600596, 22204817, 22271878, 22461641, 22462616, 23095323, 23098512, 23193072, 23340297, 23613317, 23674495, 23828443, 23986257, 24029602, 24336068, 24416729, 24548766, 24551119, 24647569, 24714771, 24778130, 24848257, 24955518, 25009014, 25079317, 25193987, 25223485, 25287912, 25370533, 25392179, 25428505, 25494679, 25499621, 25538263, 25597412, 25609200, 25658629, 25669979, 25682184, 25695955, 25774992, 25792524, 25862146, 25895031, 25895097, 25940795, 25944800, 25963805, 25977340, 25998800, 26014095, 26014096, 26041877, 26086854, 26181000, 26181250, 26323609, 26337747, 26359984, 26375401, 26408403, 26423423, 26431376, 26473645, 26477471, 26501438, 26503055, 26541606, 26554829, 26573597, 26581194, 26625196, 26625204, 26627015, 26631501, 26637667, 26707383, 26707870, 26801886, 26822379, 26833127, 26859684, 26861458, 26871284, 26871470, 26901614, 26913631, 26918453, 26937756, 26943572, 26945902, 26952546, 26954523, 26960397, 26965581, 26966191, 26973128, 27045512, 27045886, 27050074, 27061215, 27107327, 27117531, 27147580, 27189072, 27191996, 27196573, 27196778, 27197062, 27198569, 27217541, 27225694, 27237031, 27248318, 27269947, 27310809, 27341634, 27346415, 27354481, 27370400, 27393509, 27403706, 27404452, 27422273, 27444986, 27456947, 27463676, 27465786, 27466552, 27468881, 27484791, 27491898, 27496650, 27502709, 27541827, 27544053, 27552968, 27553906, 27565919, 27568346, 27571538, 27581532, 27589570, 27591097, 27595232, 27597284, 27620277, 27623354, 27629881, 27639678, 27655724, 27663086, 27667773, 27671674, 27692344, 27697578, 27707838, 27737703, 27747247, 27777774, 27777777, 27788043, 27797973, 27801734, 27801735, 27813511, 27815126, 27816392, 27816393, 27825291, 27827313, 27834350, 27861596, 27864219, 27870715, 27903604, 27910859, 27913228, 27913861, 27919908, 27922697, 27925176, 27926518, 27932443, 27934877, 27935862, 27936870, 27960080, 27966264, 27974689, 27979840, 27984238, 27986748, 27987237, 28017495, 28024695, 28025143, 28038471, 28039162, 28052400, 28054442, 28055269, 28058578, 28059093, 28059094, 28065619, 28073774, 28073845, 28076847, 28084337, 28096371, 28096505, 28096683, 28104537, 28107186, 28111119, 28112370, 28114249, 28131785, 28137741, 28139862, 28145884, 28148715, 28152514, 28166181, 28167507, 28168303, 28169111, 28174141, 28180998, 28184224, 28184968, 28185198, 28188185, 28188721, 28193626, 28195880, 28197362, 28197370, 28201746, 28202921, 28212060, 28213726, 28220772, 28222308, 28223273, 28230773, 28231855, 28233639, 28235763, 28236980, 28247187, 28254435, 28266500, 28270499, 28274999, 28278348, 28280600, 28286742, 28288138, 28289861, 28291636, 28294486, 28301259, 28301925, 28302645, 28306559, 28314298, 28314313, 28314315, 28314785, 28314962, 28315964, 28321814, 28334399, 28341226, 28344809, 28344870, 28344882, 28345650, 28347512, 28351581, 28351930, 28363612, 28363643, 28367063, 28368722, 28383777, 28391420, 28393361, 28403223, 28404915, 28405501, 28405512, 28406723, 28407039, 28410210, 28412591, 28415820, 28416123, 28419181, 28419539, 28420421, 28423520, 28423552, 28423711, 28424162, 28424330, 28428193, 28430626, 28434399, 28438290, 28442920, 28445951, 28446544, 28447277, 28449473, 28453554, 28460468, 28463396, 28465485, 28466375, 28468947, 28476792, 28476872, 28477372, 28478231, 28483787, 28487100, 28489510, 28490949, 28494868, 28496107, 28501937, 28504999, 28507803, 28511705, 28512174, 28515246, 28522738, 28522811, 28524003, 28529902, 28531337, 28534531, 28543699, 28549836, 28552987, 28555079, 28564605, 28569410, 28571578, 28576522, 28579282, 28588151, 28591697, 28599483, 28602029, 28606922, 28608950, 28611201, 28613923, 28619999, 28622889, 28623775, 28623908, 28625622, 28627792, 28629895, 28633409, 28635644, 28638740, 28641100, 28645491, 28650673, 28652780, 28657901, 28662677, 28666643, 28667193, 28669849, 28671973, 28675174, 28676221, 28679765, 28680745, 28688685, 28693258, 28693793, 28707500, 28710313, 28711324, 28711734, 28711968, 28713682, 28714960, 28716069, 28716437, 28719380, 28721097, 28724663, 28728868, 28737763, 28751245, 28752845, 28754746, 28758106, 28762116, 28771603, 28775777, 28776578, 28778959, 28780933, 28788102, 28791392, 28795532, 28797130, 28797844, 28801607, 28801853, 28806116, 28806299, 28807004, 28807048, 28811252, 28811961, 28811971, 28813164, 28813410, 28813417, 28815764, 28818019, 28819064, 28819402, 28828496, 28829153, 28835386, 28837143, 28838391, 28841687, 28843709, 28846888, 28848143, 28848559, 28851046, 28851662, 28860576, 28868758, 28870260, 28871595, 28874817, 28878676, 28881104, 28881488, 28881674, 28884747, 28886381, 28892775, 28892778, 28893901, 28894845, 28900290, 28903317, 28903377, 28912897, 28913723, 28914674, 28916815, 28919987, 28922567, 28922790, 28923100, 28925087, 28925793, 28928158, 28931635, 28932565, 28932643, 28938605, 28938671, 28942432, 28954788, 28959173, 28963773, 28967485, 28969039, 28969052, 28969070, 28969885, 28974431, 28977890, 28978000, 28978117, 28982322, 28982883, 28994323, 29016555, 29025424, 29025984, 29028787, 29029502, 29029512, 29033182, 29034210, 29034543, 29037958, 29041905, 29042640, 29044503, 29045540, 29049375, 29050367, 29051990, 29053414, 29053481, 29055949, 29056539, 29057236, 29057919, 29059432, 29061772, 29061774, 29063313, 29066497, 29069274, 29072624, 29081778, 29083399, 29088859, 29090321, 29097421, 29100397, 29101058, 29103968, 29105302, 29110262, 29110847, 29110857, 29111177, 29113315, 29113661, 29114547, 29116900, 29117944, 29118259, 29122838, 29123950, 29123964, 29123967, 29126088, 29129441, 29135534, 29137273, 29137285, 29137398, 29146060, 29147618, 29147863, 29153898, 29156488, 29157298, 29163490, 29163797, 29175457, 29182441, 29185392, 29187455, 29187883, 29189264, 29190949, 29190964, 29191596, 29192647, 29194117, 29195116, 29206673, 29206680, 29208565, 29209560, 29216535, 29217527, 29219612, 29223828, 29228707, 29233904, 29237087, 29238224, 29243049, 29243222, 29245908, 29245981, 29246182, 29246442, 29246835, 29249397, 29250533, 29254220, 29255458, 29258072, 29262573, 29267866, 29268948, 29269008, 29274784, 29275462, 29277762, 29282694, 29283791, 29284010, 29288043, 29291717, 29296194, 29296537, 29296542, 29296784, 29298869, 29308306, 29308311, 29309297, 29309540, 29311707, 29312360, 29320474, 29322427, 29322798, 29326088, 29328976, 29336717, 29337303, 29337304, 29337305, 29340095, 29345283, 29346540, 29348848, 29350470, 29351920, 29356178, 29357948, 29358502, 29360724, 29360727, 29361135, 29362132, 29362922, 29365144, 29368125, 29374053, 29377881, 29378266, 29378725, 29380399, 29383037, 29383103, 29386574, 29394125, 29399387, 29399389, 29400599, 29405663, 29405973, 29409471, 29411536, 29413045, 29415126, 29416054, 29416107, 29419531, 29423109, 29423114, 29427150, 29429897, 29432222, 29434366, 29434933, 29435074, 29435131, 29435162, 29436178, 29438172, 29438316, 29438713, 29440293, 29443960, 29444918, 29445891, 29449276, 29449680, 29453963, 29462123, 29464065, 29466476, 29467933, 29467945, 29473471, 29480817, 29483207, 29484143, 29484144, 29484464, 29485980, 29486799, 29487713, 29489025, 29491058, 29491064, 29492219, 29504948, 29505109, 29507197, 29509940, 29510096, 29514216, 29516506, 29516978, 29518341, 29520483, 29523759, 29524062, 29525632, 29525633, 29530070, 29532035, 29534030, 29535832, 29539425, 29541402, 29543932, 29544718, 29545095, 29547766, 29549910, 29552135, 29552177, 29552300, 29559561, 29559741, 29562194, 29566951, 29568117, 29568358, 29571084, 29572003, 29572007, 29572029, 29575535, 29581543, 29584545, 29588392, 29593314, 29593736, 29593888, 29593889, 29598887, 29599908, 29600072, 29601633, 29602174, 29607663, 29609906, 29614789, 29617441, 29617574, 29623256, 29625053, 29634978, 29641940, 29642086, 29642147, 29643764, 29651624, 29653410, 29655565, 29658430, 29658845, 29658848, 29658856, 29661736, 29661791, 29662547, 29663398, 29667169, 29670378, 29672367, 29672601, 29673110, 29674442, 29679564, 29683761, 29685882, 29691471, 29695237, 29702286, 29703766, 29704674, 29706653, 29707344, 29715119, 29716887, 29716923, 29719073, 29721192, 29721371, 29723688, 29727332, 29729581, 29730461, 29731605, 29732001, 29736798, 29742291, 29742559, 29743104, 29744030, 29744662, 29748004, 29752314, 29755688, 29757193, 29764856, 29773326, 29773717, 29775689, 29775808, 29776633, 29779068, 29779430, 29782924, 29789013, 29794562, 29800589, 29800747, 29805708, 29805739, 29843803, 29843813, 29844686, 29844707, 29845474, 29846894, 29848031, 29854854, 29857892, 29858030, 29859006, 29859152, 29862874, 29866156, 29868471, 29872507, 29872566, 29872567, 29872568, 29874226, 29874546, 29876215, 29878757, 29882235, 29882997, 29884413, 29884866, 29898687, 29900038, 29900051, 29900052, 29901173, 29902298, 29910061, 29910728, 29914097, 29915957, 29921949, 29936058, 29937943, 29942303, 29946185, 29948239, 29949442, 29949671, 29950349, 29951304, 29953115, 29954240, 29957683, 29959712, 29960831, 29961778, 29962847, 29967259, 29969606, 29970498, 29971465, 29973653, 29973670, 29992764, 29996099, 29996881, 30003113, 30003574, 30009831, 30012051, 30012633, 30012853, 30014686, 30015384, 30016964, 30018044, 30025443, 30026337, 30032144, 30032257, 30033186, 30035369, 30037849, 30041679, 30042205, 30048250, 30049749, 30054295, 30055582, 30056164, 30057891, 30059455, 30059678, 30062756, 30063587, 30064200, 30066852, 30067880, 30068796, 30074503, 30075156, 30077124, 30078505, 30082870, 30082893, 30085020, 30085937, 30089601, 30095468, 30095976, 30096401, 30096704, 30107136, 30110194, 30112112, 30120163, 30123214, 30123257, 30123362, 30126069, 30131293, 30131308, 30132082, 30132131, 30133286, 30134171, 30134343, 30139382, 30141009, 30142953, 30144808, 30145359, 30152019, 30153998, 30154227, 30159779, 30161295, 30165371, 30166615, 30171052, 30171197, 30172884, 30173944, 30177687, 30191417, 30197262, 30198904, 30203184, 30206229, 30209885, 30214445, 30216999, 30219896, 30221041, 30221046, 30221051, 30221053, 30221062, 30224753, 30225784, 30227708, 30232519, 30236595, 30238975, 30239046, 30241942, 30242306, 30250590, 30253973, 30254402, 30254644, 30259976, 30264678, 30267213, 30268448, 30272332, 30275099, 30275232, 30275703, 30282672, 30282880, 30283733, 30285856, 30288340, 30291344, 30291913, 30294328, 30296523, 30297397, 30297881, 30301530, 30301864, 30304846, 30309853, 30312607, 30314669, 30315719, 30319648, 30320751, 30322947, 30323352, 30323626, 30323667, 30323963, 30324091, 30325558, 30326786, 30327563, 30327655, 30333036, 30333313, 30343006, 30343514, 30343614, 30344922, 30345906, 30349382, 30353144, 30357491, 30357969, 30361911, 30366077, 30368626, 30373602, 30373750, 30374200, 30377559, 30377572, 30378264, 30381467, 30385260, 30385408, 30387230, 30387832, 30388926, 30389315, 30389912, 30390643, 30392153, 30394118, 30396996, 30401947, 30401949, 30405135, 30406373, 30407098, 30407895, 30409126, 30411509, 30412106, 30416665, 30418192, 30418532, 30419854, 30425022, 30426611, 30428640, 30429008, 30429043, 30429368, 30429378, 30442684, 30442705, 30443950, 30445271, 30446588, 30448697, 30448924, 30449485, 30450335, 30452269, 30455128, 30457978, 30458835, 30458852, 30459153, 30460579, 30462163, 30463782, 30475455, 30475947, 30476528, 30477643, 30478349, 30478423, 30479334, 30486741, 30486888, 30487133, 30487606, 30497521, 30498230, 30499814, 30500835, 30505712, 30505713, 30508944, 30514666, 30515719, 30518694, 30518877, 30519541, 30519815, 30521746, 30522700, 30522901, 30524879, 30524900, 30524905, 30527665, 30528043, 30528699, 30528799, 30536665, 30536734, 30537104, 30537988, 30538110, 30539796, 30539847, 30539869, 30544743, 30546030, 30546955, 30547271, 30548363, 30552520, 30557521, 30563569, 30564277, 30565657, 30565707, 30570649, 30582788, 30583461, 30586539, 30589949, 30592196, 30594747, 30596074, 30600919, 30605211, 30607162, 30609118, 30609938, 30616523, 30617131, 30619746, 30620878, 30621390, 30622322, 30632130, 30633894, 30636374, 30639618, 30640692, 30640753, 30642373, 30642552, 30642913, 30643286, 30645700, 30646854, 30646912, 30647082, 30647844, 30647851, 30651147, 30651729, 30652379, 30653481, 30653520, 30653748, 30654186, 30655791, 30655866, 30657853, 30659055, 30659987, 30662542, 30664822, 30667073, 30670497, 30675299, 30677447, 30678715, 30679441, 30681807, 30683629, 30684971, 30688388, 30692096, 30700576, 30702189, 30705400, 30709424, 30711649, 30714229, 30719168, 30723299, 30723303, 30723578, 30726175, 30728907, 30730279, 30730407, 30731276, 30732956, 30733932, 30735815, 30742122, 30744692, 30747725, 30753274, 30755167, 30755690, 30755733, 30762153, 30762585, 30768970, 30769852, 30770362, 30770442, 30775032, 30776071, 30777100, 30781490, 30785829, 30790069, 30791940, 30794891, 30797818, 30802149, 30803931, 30808413, 30819829, 30821864, 30822683, 30824583, 30824609, 30825132, 30827759, 30832606, 30833750, 30833751, 30840203, 30841910, 30846480, 30852560, 30852949, 30854124, 30855527, 30860657, 30861172, 30864729, 30867242, 30872703, 30873585, 30874607, 30874889, 30885276, 30885341, 30885349, 30888929, 30895946, 30899426, 30902885, 30906668, 30912805, 30912808, 30913016, 30916923, 30925904, 30925928, 30926062, 30927618, 30929569, 30930222, 30934955, 30935888, 30936321, 30940805, 30941125, 30941773, 30943124, 30947564, 30949408, 30951669, 30952714, 30952734, 30953116, 30959852, 30962002, 30962996, 30963235, 30967647, 30969179, 30972492, 30972888, 30972999, 30973703, 30977385, 30978575, 30979816, 30981637, 30983436, 30986253, 30986912, 30986992, 30987368, 30993371, 30996253, 31001479, 31002007, 31003463, 31008763, 31009388, 31010620, 31010836, 31011254, 31011905, 31013423, 31014354, 31014381, 31019444, 31019947, 31026471, 31027907, 31030234, 31030326, 31031765, 31039792, 31040917, 31043352, 31046484, 31047727, 31050216, 31056702, 31058656, 31060602, 31060796, 31061067, 31063864, 31064408, 31067796, 31069140, 31071366, 31071371, 31075727, 31076549, 31076855, 31081058, 31088500, 31089757, 31090214, 31090219, 31095287, 31096176, 31097091, 31101455, 31101760, 31109153, 31111437, 31112529, 31112973, 31113805, 31113840, 31117034, 31118488, 31118648, 31125352, 31128036, 31128313, 31129768, 31130676, 31132649, 31134150, 31136972, 31138162, 31138727, 31139018, 31141610, 31142513, 31146442, 31146499, 31151983, 31152546, 31155004, 31159302, 31166373, 31171876, 31173242, 31175402, 31177146, 31178388, 31179334, 31186247, 31186528, 31187691, 31190869, 31190987, 31191013, 31197557, 31200821, 31201825, 31201935, 31205530, 31205619, 31209954, 31209979, 31212055, 31212653, 31212989, 31214178, 31214790, 31221150, 31221178, 31227501, 31228073, 31231126, 31237963, 31239318, 31239321, 31240875, 31243779, 31244820, 31248966, 31251403, 31252039, 31253167, 31253743, 31258479, 31258527, 31260834, 31261165, 31262041, 31262689, 31267201, 31267202, 31269329, 31270941, 31271855, 31275983, 31279641, 31281485, 31283253, 31285589, 31285612, 31287031, 31287562, 31291716, 31291983, 31292145, 31294762, 31294893, 31295966, 31299381, 31299636, 31299995, 31300478, 31307547, 31308749, 31310587, 31312140, 31315901, 31318407, 31319978, 31319982, 31319996, 31320000, 31331818, 31335487, 31337644, 31343994, 31348579, 31349612, 31353229, 31359214, 31361169, 31363159, 31366361, 31366557, 31368078, 31368625, 31371279, 31371341, 31372044, 31374957, 31382969, 31383016, 31383651, 31383732, 31383957, 31384666, 31385405, 31385407, 31387102, 31387181, 31388183, 31392467, 31392549, 31398408, 31399043, 31399559, 31400163, 31404614, 31406255, 31406485, 31409612, 31409638, 31409885, 31410753, 31412943, 31415379, 31417906, 31417907, 31420048, 31420468, 31421256, 31421259, 31422157, 31423245, 31424637, 31428517, 31428525, 31428528, 31429779, 31432460, 31436822, 31437792, 31437795, 31439714, 31442817, 31446140, 31446994, 31449889, 31451991, 31452748, 31452749, 31453054, 31454018, 31454429, 31455411, 31458997, 31462002, 31463730, 31465113, 31467175, 31469965, 31470546, 31477145, 31479512, 31480591, 31481045, 31482306, 31483286, 31486884, 31490702, 31491661, 31492714, 31498156, 31499335, 31500143, 31500267, 31501892, 31502013, 31502147, 31502169, 31502170, 31511071, 31511565, 31511925, 31513320, 31519573, 31519868, 31521051, 31523194, 31526368, 31527709, 31533832, 31533840, 31535550, 31536478, 31545419, 31545446, 31546725, 31546897, 31546905, 31550464, 31551657, 31555511, 31555517, 31555518, 31555701, 31557787, 31558782, 31558971, 31562796, 31563736, 31564903, 31570897, 31572677, 31581535, 31582185, 31584451, 31585433, 31591439, 31593039, 31600397, 31604537, 31605439, 31605792, 31608727, 31611650, 31612048, 31612217, 31613799, 31614500, 31615933, 31616157, 31616289, 31620857, 31623180, 31625289, 31625630, 31626963, 31632619, 31633227, 31634533, 31637423, 31640798, 31644329, 31644929, 31646095, 31646101, 31646108, 31647026, 31649669, 31651174, 31651527, 31652685, 31653140, 31655605, 31659256, 31660074, 31664962, 31665020, 31672701, 31674884, 31678168, 31679121, 31679792, 31679823, 31681568, 31683094, 31683168, 31683962, 31684954, 31685233, 31686860, 31690181, 31691957, 31693508, 31695808, 31697809, 31702880, 31703604, 31704149, 31704289, 31704881, 31705171, 31705737, 31709671, 31710313, 31712383, 31720814, 31721643, 31722674, 31722999, 31727249, 31727629, 31730010, 31730012, 31730502, 31741201, 31741753, 31744296, 31746127, 31747139, 31747941, 31748880, 31749060, 31759368, 31760568, 31762164, 31767795, 31775585, 31777599, 31778799, 31781843, 31783532, 31785018, 31785431, 31785814, 31788072, 31793634, 31799599, 31800094, 31802034, 31804230, 31805690, 31806779, 31806995, 31807880, 31808243, 31809310, 31811434, 31812347, 31814954, 31815045, 31817719, 31819612, 31819973, 31821665, 31822499, 31823654, 31823919, 31824835, 31829518, 31836325, 31837884, 31841269, 31842958, 31843683, 31850219, 31850228, 31851060		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	31040917		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29069649, 30765734		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25368235, 27548033		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	29427150		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28270499, 28608950, 29070883, 29196189, 29296542, 29377881, 31480495		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28608950, 33239635, 33655954, 34738358, 35525858, 37130627, 38125723, 39512342	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28625622, 28837143, 28925087, 28980429, 29187498, 29326364, 29434915, 29599916, 29789013, 30400003, 30546030, 30746237, 31557757		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	29427150		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	29427150		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29137242, 29427150		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	27588404, 28832074	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32193699, 39321200	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31575949		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	35427471, 37890351	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28115915, 31503548		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	27341634, 28351581		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27708232, 27998726		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	29296784		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23167931, 24029602, 24162015, 24217091, 24880938, 25009014, 25207460, 25349974, 25592115, 25597412, 25609202, 25658629, 25682184, 25801750, 25862146, 25895031, 25901080, 25937270, 25998384, 26019170, 26024796, 26086854, 26317305, 26349666, 26473645, 26501438, 26631501, 26637667, 26707383, 26762740, 26822379, 26898608, 26944305, 26954523, 26973128, 27050074, 27106868, 27107327, 27137346, 27181838, 27189072, 27297395, 27310809, 27342566, 27393506, 27393509, 27485075, 27496650, 27499357, 27553831, 27565919, 27565935, 27571538, 27581532, 27597284, 27639678, 27801735, 27816392, 27816393, 27834350, 27838455, 27841044, 27846317, 28033249, 28073845, 28096505, 28129007, 28132868, 28137741, 28152514, 28168303, 28188721, 28197362, 28207525, 28214087, 28222447, 28223273, 28236980, 28245875, 28259530, 28260924, 28275222, 28278348, 28288138, 28301925, 28318951, 28332580, 28335643, 28341875, 28387300, 28407039, 28420726, 28423587, 28427522, 28449473, 28451792, 28460468, 28466250, 28472902, 28476792, 28478231, 28484456, 28499515, 28503213, 28507793, 28515246, 28529902, 28539467, 28549039, 28549836, 28600190, 28609226, 28613923, 28616701, 28620848, 28623122, 28624922, 28633409, 28636851, 28667193, 28669849, 28676221, 28677815, 28688973, 28697065, 28700789, 28705024, 28714960, 28716463, 28719380, 28739315, 28739710, 28751245, 28756224, 28761384, 28786318, 28795418, 28797130, 28803721, 28806116, 28818019, 28818609, 28820000, 28822887, 28829153, 28835386, 28835513, 28838391, 28838509, 28849209, 28851100, 28851662, 28860576, 28880013, 28881674, 28881856, 28892778, 28900290, 28901258, 28915714, 28932563, 28932565, 28932637, 28938570, 28938671, 28938692, 28959173, 28960263, 28969070, 28977890, 28978110, 28980429, 28982891, 29024471, 29031195, 29036261, 29036791, 29053224, 29053400, 29057236, 29057919, 29059432, 29069958, 29074606, 29082853, 29084031, 29088766, 29095271, 29101058, 29107330, 29110835, 29113321, 29115057, 29119113, 29123964, 29124315, 29125731, 29129441, 29137398, 29145737, 29146060, 29147605, 29150906, 29152077, 29153898, 29156447, 29158791, 29158797, 29163815, 29168339, 29175386, 29187455, 29187498, 29187883, 29191596, 29191606, 29194117, 29203588, 29209070, 29209560, 29214427, 29228707, 29233789, 29243049, 29247502, 29254184, 29268554, 29269008, 29277823, 29290252, 29290267, 29290777, 29296193, 29296194, 29296537, 29299404, 29309815, 29322798, 29323731, 29346180, 29351573, 29352857, 29361135, 29364514, 29366663, 29371947, 29374053, 29374699, 29374744, 29383034, 29383038, 29383103, 29385894, 29416054, 29423109, 29423118, 29425258, 29433902, 29435109, 29435131, 29463302, 29473467, 29473504, 29476608, 29484143, 29484144, 29487223, 29491064, 29499101, 29509748, 29510096, 29510739, 29526752, 29530732, 29544718, 29545095, 29549910, 29566951, 29567557, 29568386, 29572000, 29572007, 29593890, 29607153, 29609906, 29614306, 29617683, 29628312, 29650000, 29657128, 29659668, 29662547, 29675101, 29679564, 29695832, 29704674, 29707129, 29713040, 29721376, 29723688, 29726585, 29731605, 29735366, 29746230, 29748004, 29758930, 29760800, 29767245, 29769148, 29773717, 29794870, 29844002, 29856861, 29871672, 29874226, 29874546, 29901173, 29901568, 29901571, 29931587, 29938855, 29947012, 29948239, 29951297, 29951298, 29951309, 29952768, 29958099, 29970498, 29978725, 29991499, 29996738, 30002656, 30016964, 30017645, 30019319, 30019892, 30024424, 30038505, 30041679, 30052717, 30056164, 30058723, 30059678, 30061230, 30075155, 30082870, 30082893, 30084040, 30087855, 30089590, 30095468, 30101000, 30105871, 30111979, 30113497, 30125216, 30142174, 30159341, 30165371, 30173280, 30193240, 30205806, 30206165, 30207786, 30209885, 30217492, 30225784, 30237726, 30253080, 30253973, 30262187, 30262399, 30267840, 30267842, 30268448, 30275216, 30280635, 30282880, 30285770, 30288054, 30297397, 30307348, 30318514, 30320488, 30320751, 30341017, 30344651, 30345301, 30348714, 30378264, 30383701, 30393621, 30401947, 30405135, 30407231, 30419350, 30425022, 30425517, 30428640, 30429008, 30429026, 30445271, 30446226, 30448912, 30464501, 30464517, 30470252, 30475455, 30478349, 30482633, 30489337, 30500997, 30504406, 30505708, 30505709, 30505713, 30509312, 30514390, 30515719, 30524878, 30527198, 30528799, 30534975, 30536734, 30539506, 30548240, 30565869, 30577837, 30584321, 30586539, 30587623, 30588196, 30589644, 30592196, 30612418, 30617131, 30618179, 30622322, 30628185, 30635009, 30639618, 30640753, 30642442, 30642449, 30642547, 30642550, 30642552, 30642913, 30646794, 30647851, 30651938, 30653748, 30657853, 30662542, 30679441, 30681807, 30686251, 30709424, 30711649, 30725206, 30728907, 30738221, 30744692, 30745585, 30746216, 30758227, 30765392, 30766753, 30769852, 30772141, 30775030, 30775032, 30777100, 30784054, 30785829, 30789848, 30796032, 30796165, 30797490, 30810279, 30816954, 30819828, 30819829, 30826426, 30832704, 30842489, 30844110, 30846480, 30847464, 30854949, 30862891, 30867242, 30872362, 30876831, 30879776, 30885328, 30885355, 30903517, 30912805, 30935099, 30940805, 30946323, 30952742, 30956278, 30969033, 30972766, 30975694, 30977778, 30978241, 30984621, 30986253, 30986912, 30987236, 31002006, 31003463, 31016875, 31018251, 31021918, 31025831, 31027705, 31030326, 31031204, 31033100, 31041879, 31046714, 31050216, 31053172, 31060602, 31063806, 31063864, 31085721, 31088500, 31089757, 31092453, 31097091, 31106827, 31111063, 31113840, 31117034, 31118648, 31118808, 31121194, 31122901, 31125062, 31125352, 31127385, 31128201, 31130676, 31134811, 31147234, 31155995, 31156344, 31159869, 31164319, 31166373, 31173242, 31174496, 31179053, 31179334, 31181973, 31182061, 31186735, 31189645, 31196138, 31209954, 31212653, 31212989, 31214790, 31216560, 31228073, 31228184, 31237079, 31237152, 31238177, 31240979, 31245924, 31253167, 31253869, 31260834, 31262041, 31262689, 31283253, 31289485, 31291995, 31294749, 31295966, 31297962, 31308749, 31315901, 31319978, 31319982, 31319988, 31319996, 31320000, 31326706, 31331328, 31342270, 31348821, 31365588, 31374957, 31383957, 31387256, 31388183, 31392549, 31399559, 31404614, 31415404, 31421256, 31421259, 31424637, 31432460, 31432705, 31435660, 31436226, 31438923, 31446994, 31447062, 31454429, 31463730, 31482306, 31488176, 31494258, 31497071, 31499335, 31511069, 31511071, 31512401, 31512526, 31516897, 31517642, 31526368, 31527709, 31531785, 31541338, 31546072, 31546725, 31550464, 31552167, 31555511, 31555516, 31555517, 31555518, 31562796, 31605792, 31605795, 31607917, 31615933, 31619231, 31627272, 31630044, 31634667, 31644929, 31645901, 31646074, 31654203, 31665020, 31684954, 31686247, 31693178, 31704288, 31711463, 31718692, 31719056, 31722999, 31728860, 31730010, 31731818, 31738117, 31741764, 31745593, 31747941, 31772851, 31777599, 31778799, 31782989, 31786476, 31792836, 31793055, 31798692, 31803366, 31808243, 31810952, 31815565, 31819612, 31822512, 31823919, 31838881, 31841269, 31843013, 31843683, 31851430		★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	31802108		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28373294, 30984969, 31101455		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	29538329		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27494857, 34330510	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30420753, 31741761		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36714595	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	36951523	Associate	★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27979383		★☆☆☆☆ Found in Text Mining only
Optic Atrophy Autosomal Dominant	Optic atrophy	Pubtator	37495171	Inhibit	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	29113315, 29271789, 31010620		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	32235905, 34903527, 37081578	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39388456	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34056703	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24866169, 25751499, 27853827, 28045576, 28415820, 28650673, 28938660, 29117898, 29170130, 29225166, 29409495, 29733528, 30026851, 30430228, 30448697, 30524885, 30775238, 31040694, 31128313, 31219973, 31437795, 31485666, 31535847, 31842180		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24866169, 27456063, 27853827, 28415820, 31981455, 32388585, 33457085, 34196706, 35326493, 36519392, 36739599, 37951196, 37993664	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26625204, 28065619, 29485423, 30412078, 31039792, 31851060		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29027395		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian Diseases	BEFREE	26541760		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28125702, 32334621	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17360651		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23340297, 24297569, 25081699, 25998800, 26541760, 26573793, 26625204, 27626654, 27671674, 27986748, 28065619, 28266500, 28752845, 29055949, 29171115, 29171986, 29337305, 29496294, 29843813, 30045136, 30078505, 30207101, 30522700, 30582756, 30702189, 30802149, 31039792, 31311810, 31432577, 31492714, 31533774, 31611650, 31695427, 31781843, 31799599, 31821542		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17360651, 24297569, 25081699, 26541760, 26625204, 26871470, 26937756, 27986748, 28187748, 28266500, 28752845, 29027395, 29171986, 29212506, 29351920, 29485423, 29843813, 30045136, 30135206, 31208449, 31432577, 31492714, 31799599, 31821542, 31892360, 31980961, 32012411, 32398324, 32404957, 32446718, 32487171, 32504248, 32649682, 33062717, 33247999, 33492447, 33737722, 33811746, 34275654, 34425872, 34502561, 34527431, 34620163, 34656305, 34745124, 34768993, 34946254, 35026984, 35137909, 35187890, 35320892, 35545291, 35820543, 36581850, 36601114, 36604635, 36683495, 36707884, 36726489, 36757936, 37179293, 37339172, 37420173, 37446361, 37452634, 37681751, 37759229, 37791232, 38276058, 39587817	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37221583	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	31208449, 31337420		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18347814, 24378899, 25795132, 26423423, 27402485, 27589570, 27797936, 28030840, 28112370, 28131992, 28442920, 28769571, 28826722, 29069274, 29081663, 29100036, 29385739, 29576277, 29599908, 29999557, 30029936, 30214445, 30254451, 30301530, 30377341, 30653106, 30670333, 30709380, 30886310, 30927618, 30991694, 31032528, 31069140, 31101760, 31179334, 31206665, 31284422, 31291716, 31423221, 31440238, 31608800, 31818309, 31837335		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27932443, 28007776, 28314962, 28870260, 28912094, 29069274, 29378617, 29576277, 30426611, 30927618, 31069140, 31433988		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28131992, 29204701, 29459478, 31101760, 31837335		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20035626, 23029049, 23359812, 25795132, 27589570, 28030840, 29999557, 30426611, 30458888, 31032528, 31043417, 31068935, 31128036, 31284422, 31399545, 31440238, 32051287, 32643277, 33062072, 34400885, 35177078, 35222383, 35271750, 35348737, 35624419, 35953822, 36203575, 36405738, 37130628, 37244388, 37369808, 37642079, 37881431, 40301983	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28705256, 30153220, 30185888, 31399545	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31076344, 31135488		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31135488		★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	29509940		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28086852		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24955518, 27825291, 28093480, 28974264, 29128181, 29651624, 30121940, 30913016, 31252406		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	22322668, 28940446, 30842242		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	22322668, 28940446, 35815785, 38193541	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	30594747		★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	29775807	Associate	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	31201935, 31796119		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	23750452	Stimulate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	33767694	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	30033186		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	30033186, 31252398		★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	29483289		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29762141		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24378899, 28602029, 29069274, 30927618, 31433988, 31490702		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	30953116, 32730911	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	BEFREE	30320114		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	34449004	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial Effusion	Pericardial effusion	Pubtator	33181636	Associate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	30851443		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26847035, 30923536		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32041789, 32210958	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	38172197	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31552184		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	34102137	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31552184		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29245981, 29380399, 30054295, 30890046, 31017033, 31074879, 31191027		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	27544053, 31407221	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33580098, 33737722, 37970475	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37768208	Stimulate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30594747		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	36314599, 37406931	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	26321864		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	27655724, 29680903		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	27655724		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	27655724, 30609812, 33112279, 34745002, 37424874	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	28980429, 30568128, 39382248	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	34384268	Stimulate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29411536, 30046124, 30320751, 31639551		★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	29427150		★☆☆☆☆ Found in Text Mining only
Poikiloderma with Neutropenia	Poikiloderma With Neutropenia	BEFREE	29960831		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30463956		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	30463956		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	BEFREE	22204817		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33521133	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia Vera	Polycythemia vera	Pubtator	31348821, 35015307	Associate	★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	31522278		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30466764, 31503548		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31836919		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30692527		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	31359214		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28982883, 29067721, 29152083, 30723112		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	BEFREE	29601633, 30860657, 31570483		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31522278		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18850006, 20971039, 26260996, 26573597, 27363678, 27462860, 27835597, 28223102, 28461179, 28797844, 28893901, 29125731, 29160310, 29360724, 29392925, 29535806, 29577933, 29582792, 29641940, 29679564, 30257853, 30321406, 30537104, 30541755, 30610805, 30709785, 30733677, 30827759, 30890551, 30984182, 31035590, 31182913, 31261165, 31289580, 31545446, 31567999, 31641355, 31653272, 31697036		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26260996, 27462860, 27835597, 28223102, 28460462, 29117944, 29212506, 29577933, 30179225, 30385408, 30399174, 30610805, 31035590, 31090214, 31431617, 31545446, 31567999, 31703602, 32203167, 32592689, 32616555, 33899001, 34032524, 34168052, 34222466, 34271938, 34417325, 34440920, 34573332, 34737749, 35013615, 35042311, 35154101, 35764368, 35846769, 36093754, 36389756, 36524848, 36930173, 37067635, 37170264, 37223924, 38129557, 38189834, 39265220, 39809175, 40107012	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28345023, 30827759		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30488530	Stimulate	★☆☆☆☆ Found in Text Mining only
Psammomatous Meningioma	Psammomatous Meningioma	BEFREE	28974264		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27185339, 32430334, 35844567, 35848967, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29096940, 30341238		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	39769220	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25775429, 26517304, 27252415, 31481045, 32915645, 35860812, 36575294, 37260034	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30037849, 31481045		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29220578, 30763282		★☆☆☆☆ Found in Text Mining only
Radiation-Induced Cancer	Radiation-Induced Cancer	CTD_human_DG	28736328		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28721097, 29165286, 29328976, 30221062, 30282671, 30405752, 30448924, 30655866, 30807610, 30874889		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	BEFREE	30681550		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	24504486, 27491898, 27801735, 28471952, 28815334, 29360724, 29983240, 30405053, 30958600, 31155004, 31672701		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17762621, 24029602, 25193987, 25538263, 26141060, 26424759, 26707870, 27426025, 27470134, 27491898, 27926518, 28210995, 28223273, 28353093, 28427522, 28471952, 28524003, 28645491, 28697172, 28807048, 28807336, 29191375, 29230210, 29260622, 29362922, 29368638, 29374054, 29423418, 29661736, 29942309, 29994900, 30048250, 30131293, 30134343, 30349421, 30450335, 30464501, 30498230, 30588196, 30702014, 30777131, 30783205, 30790069, 30934624, 30958600, 30972888, 30987368, 30992011, 31058656, 31060225, 31060796, 31076547, 31155004, 31383732, 31428205, 31494951, 31519573, 31557787, 31653140, 31732494, 31817109, 31841221		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	18756622, 30062756, 32394602, 32751328, 33130956, 33606065, 33740124, 34050578, 36397276, 37017991, 38320909	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17003458		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32100078, 33538768	Associate	★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	30854100		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	30996253	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24848257, 28688724, 29898687		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	27135656, 27393385, 28832074, 30400799, 31704149, 32294103, 34276259, 35371041, 37233406	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17597384, 19395451, 29489833, 29774031, 29961175, 30140263, 30327652		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	27617656, 34334005, 37206297	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	31598989	Inhibit	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	32750756	Stimulate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	33121520	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	29409471, 31484986, 32736208, 35777186, 36169795, 39187586	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	25073001, 33570446	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	31165561		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24349382, 25540867, 25805798, 25906748, 26943575, 27393385, 28463396, 28832074, 29212506, 30400799, 30765880, 30963193, 31617320, 32222780, 32294103, 32493964, 33457085, 33493383, 33570446, 33717062, 33789622, 34218652, 34276259, 34817950, 35448937, 37661910	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24866169, 25975445, 28073774, 28405501, 28405504, 28430664, 28463396, 28688724, 28819402, 28841687, 28938660, 29050367, 29155424, 29399389, 29900051, 29923984, 30400799, 31617320		★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	25805798, 28832074, 35628499	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	25805798, 39567011	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27259563, 27393385, 37993664	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	29018115	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	31394407, 32310306, 36683495	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	27393385, 28039162, 28832074, 31651363	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	32222780	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28832979		★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	29862664, 30228943, 31593039		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	29862664, 31755433, 33398391	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28188185, 29662888, 30454021, 31250346, 31413527, 31439614, 31447840		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	26598537	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	28423520	Stimulate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	29928359, 31802108		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	26183035, 33934376, 38014923, 39684323, 40398661	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	30470767, 35502507	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27782294, 27993215, 28397730, 28556912, 28973671, 29135922, 29225343, 29345058, 29393983, 29661225, 29661350, 29702526, 30036273, 30159323, 30233593, 30291379, 30431333, 30470767, 30619369, 31037153		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	35194801, 35373781	Associate	★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28460011		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	25795132, 35242133, 37267050	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	30992011, 39382248	Stimulate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	31415379	Inhibit	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	31562760		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31412888	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35020842	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	28501937, 31163235		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26957557, 33239417, 36825932	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27811935, 28849568, 29792909, 30341238		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28151757		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34254261	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34768806	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	29051270, 31019947		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29051270, 30487198, 30656807, 31019947, 31782790		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	29843813	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27329168, 27466552, 27566252, 27610620, 27620277, 27639678, 28152514, 28534531, 28625622, 28813164, 28860576, 28903317, 28925087, 29020964, 29535912, 29545095, 29762727, 29776963, 30008941, 30075155, 30077124, 30275217, 30637710, 30746237, 30777870, 30819828, 30850021, 30854074, 30910909, 31002006, 31108964, 31191745, 31209697, 31253167, 31445197, 31525648, 31549270, 31568887		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25384063, 27610620, 27620277, 28152514, 28625622, 29020964, 29049375, 30850021, 31191745, 31659278, 32586767, 33545805, 33584678, 34006632, 34149722, 34162872, 34228218, 34789716, 35126639, 35220975, 35287068, 35586668, 36053931, 36302564, 36399951, 36422799, 36473332, 37752152, 38169676, 39413714, 40362483	Associate	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic neoplasms	Pubtator	30633154	Associate	★☆☆☆☆ Found in Text Mining only
Split hand foot deformity 1	Split hand foot deformity	BEFREE	26110571		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	14559843, 21159661, 22204817, 24416729, 25009014, 26024796, 26041877, 26408403, 26637667, 26901614, 26913631, 26918453, 27438512, 27498988, 27835902, 27916470, 27922697, 28059094, 28122336, 28222447, 28314313, 28315964, 28387300, 28460468, 28496107, 28549836, 28623908, 28664936, 28669079, 28791392, 28833798, 28851662, 28870938, 28881674, 28884747, 28932563, 28932565, 28959173, 28969070, 29029502, 29036791, 29074606, 29116900, 29135534, 29137398, 29191596, 29348848, 29356178, 29374699, 29395669, 29435735, 29466476, 29510096, 29650000, 29656756, 29713040, 29736798, 29742559, 29750666, 29901571, 29969606, 30067880, 30075155, 30100056, 30305853, 30401947, 30418532, 30443950, 30487133, 30588196, 30650417, 30659749, 30767115, 30772141, 30879776, 30910351, 30972492, 31010620, 31088500, 31117034, 31159869, 31177146, 31383957, 31429521, 31437519, 31481045, 31561631, 31605439, 31718692, 31777599, 31796082, 31837884		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28039448, 28192623, 28243112, 28294486, 28314315, 28404915, 28560067, 28657901, 28949934, 29060926, 29568405, 29805749, 29855157, 29892935, 29937943, 30172884, 30174892, 30285868, 30296523, 30568505, 30570649, 30675222, 30684971, 30717285, 30767270, 31366557, 31429521, 31551657, 31582355, 31684197, 31761900		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21442435, 23179191, 23288508, 26041877, 26511814, 26562534, 26893364, 26918453, 27329726, 27498988, 27646946, 27717372, 27841362, 27922697, 28122336, 28460011, 28487502, 28496107, 28574843, 28650338, 28655941, 28756882, 28838214, 28928286, 28947422, 28948509, 29233903, 29259349, 29345283, 29395669, 29416107, 29440293, 29750666, 29992764, 30041679, 30383184, 30549362, 30564890, 30576970, 30588196, 30659749, 30767115, 30911684, 30967647, 30986253, 31113825, 31118488, 31214178, 31237963, 31243779, 31379843, 31422218, 31527697, 31623665, 31674884, 31734631, 31878938, 31881947, 31950224, 32107458, 32124416, 32238919, 32304268, 32319563, 32381551, 32448984, 32546692, 32548602, 32641320, 32669963, 32699939, 32718057, 32759978, 32802199, 33010009, 33125511, 33138288, 33208791, 33233528, 33239737, 33476742, 33596250, 33753620, 33764703, 33789303, 33972391, 34069326, 34111704, 34346116, 34375025, 34496080, 34552581, 34632870, 34657509, 34668665, 34884892, 34965944, 35034046, 35145511, 35217573, 35225458, 35281069, 35333599, 35398964, 35419461, 35456895, 35512998, 35581307, 35622885, 35691098, 35768785, 35834946, 35887397, 35941227, 36177667, 36200687, 36215771, 36455147, 36515567, 36535565, 36579984, 36826072, 36860696, 36884083, 36983005, 37108276, 37329869, 37366893, 37371594, 37462760, 37503786, 37525561, 37532831, 37663280, 37666053, 37697421, 37713790, 38003576, 38014458, 38031025, 38166970, 38229027, 38290766, 38554297, 39357980, 39930439, 39939997	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32383556, 35574984	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37483588	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	30468994		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27393509, 27565935, 27683114, 28008744, 28213003, 28341226, 28815764, 29275316, 30253973, 30642449, 30815803, 31076547, 31270941, 31299995, 31713453, 31772851		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	26918453, 28969885, 29742291		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	29113315, 29440293, 29768723, 30249348, 31113825, 31221178, 31623665, 31806878, 31837884		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28052400, 28151757, 28501937, 28666643, 28716437, 29484464, 29742559, 30411509, 30737731, 31747091		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26573233, 27683114, 28261333, 28315964, 28464441, 28476872, 28480996, 28605599, 28622889, 28650338, 28811971, 28838214, 28881780, 28932643, 28974431, 29097421, 29123967, 29147602, 29173750, 29228662, 29238207, 29259349, 29271789, 29328389, 29355614, 29434933, 29541402, 29742291, 29761938, 29848031, 29884413, 29937180, 29937998, 29946185, 29952768, 30042205, 30409325, 30462163, 30519541, 30546955, 30564890, 30619746, 30642290, 30666437, 30728908, 30846179, 30847302, 30864729, 30894369, 30895168, 30926062, 30967647, 30986253, 30987257, 31118488, 31214178, 31221178, 31237963, 31243779, 31307547, 31379843, 31527697, 31573752, 31637423, 31671550, 31674884, 31679945, 31680565, 31762164, 31848196		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29750666, 30075156		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29653410, 30588196, 31633227		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	29163797		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	28616701, 29185395, 29677240, 30735560		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	28405501, 28463396, 29900051, 31555701		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17212704, 22190470, 23430453, 24657498, 25733810, 26980034, 27147580, 27260946, 27629881, 27889799, 27934877, 28056089, 28222426, 28274999, 28412752, 28427226, 28507801, 28671728, 28754154, 28775777, 28794626, 28796808, 28910818, 28938605, 28969052, 29034543, 29073638, 29245908, 29259270, 29345842, 29399387, 29534305, 29542354, 29673110, 29690901, 29727332, 29872566, 30003113, 30120163, 30206229, 30221053, 30264329, 30353572, 30419350, 30463584, 30537988, 30552042, 30565045, 30587982, 30664822, 30670970, 30729066, 30842953, 30874607, 30925913, 31043675, 31060469, 31087180, 31110545, 31285589, 31290727, 31322226, 31372044, 31451991, 31452748, 31463730, 31471921, 31519868, 31557409, 31595457, 31620857, 31704366, 31722674, 31819504		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20646001, 29025424, 36925069, 40275321	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12800259, 24242703, 25079317, 25337246, 25733810, 26617827, 26671554, 26801886, 27009855, 27147580, 27191996, 27720576, 27741514, 27889799, 27892511, 27934877, 28056089, 28076847, 28207501, 28412752, 28427226, 28754154, 28794626, 28848143, 29025424, 29034543, 29073638, 29212506, 29259270, 29345842, 29673110, 29690901, 29854854, 29936792, 30003113, 30018250, 30028179, 30120163, 30206229, 30224753, 30282452, 30463584, 30508306, 30587982, 30704511, 30874607, 30983436, 31174544, 31285589, 31519868, 31655605, 31704366, 31722674, 31848322, 31981446, 32019283, 32089413, 32100076, 32131763, 32203213, 32373223, 32498695, 32596285, 32616848, 32943749, 32945067, 33100329, 33144421, 33288737, 33345281, 33440275, 33457080, 33479394, 33603111, 33611641, 33678158, 33753568, 33782030, 33933102, 33954872, 33972391, 34002009, 34009410, 34010049, 34098061, 34104541, 34106609, 34112882, 34126195, 34235004, 34322779, 34421887, 34497449, 34681840, 34759159, 34815356, 34828321, 34893046, 34924820, 35123909, 35220884, 35304622, 35397540, 35401534, 35485706, 35611665, 35661944, 35734348, 35778636, 35811317, 35928964, 36130326, 36213324, 36271155, 36353623, 36405009, 36454780, 36455365, 36592213, 36614254, 36640052, 36680216, 36683495, 36737759, 36761750, 37094985, 37142693, 37343324, 37366273, 37395342, 37399357, 37505759, 37563649, 37798754, 37889437, 37899172, 37945587, 38050283, 38050871, 38307189, 38350654, 38368775, 39272096, 39349535, 39593126	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	32868848, 40105370	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	35879790, 37153541, 37827134	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	31096532		★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28777458		★☆☆☆☆ Found in Text Mining only
Sweat Gland Neoplasms	Sweat gland neoplasm	Pubtator	30953116	Stimulate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28039162, 28463396		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29191375		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	26267155		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28349165, 28685821, 29775689, 30025443, 30214445, 30895352, 30962691, 31029646, 31704289		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30692527		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26171934, 26598537, 28423520	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	35586668	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	17762621		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	30385260, 33549705, 36042047	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	27166394, 27565906, 27844328, 28212996, 28771603, 29467945, 29702286, 29850538, 30168897, 30600651, 31681591		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	27565906, 27746267, 28212996, 29661720, 29850538, 30312607, 31442209, 31681591, 31683962		★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	29439008		★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	CTD_human_DG	28736328		★☆☆☆☆ Found in Text Mining only
Thyroid cancer Hurthle cell	Hurthle cell thyroid cancer	Pubtator	37529400	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	32242507, 34277966, 34580845, 37464189	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27086918, 28363612, 28974264, 30832606, 31821747, 32348468, 32750756, 32960462, 34465342, 35238073, 36518249, 37006068, 37905619, 38457034	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	30832606		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26943572, 28093480, 29455638, 29731981, 30762153, 30897754, 30913016, 31252406, 31821747		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25588542, 27045886, 29615459, 31235699, 32364844, 33509020, 34301809, 34397868, 34475850, 35574031, 36202556, 37006068, 37122752, 39586745	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	36683495	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	29372535		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29372535	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26943572, 28093480, 29455638, 29731981, 30762153, 30897754, 30913016, 31821747		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25701326, 27045886, 29372535, 30832606, 31235699, 31821747, 33247999, 35388548, 35574031, 35818041, 36974635, 36975440, 37006068, 37373171, 37501393, 37506147, 37532555, 39586745	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33509020	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	23193072, 28363612		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	29455638, 30121940, 31813343		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34074094, 34494503, 36518249	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34074094	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyrotoxicosis	Thyrotoxicosis	BEFREE	31813343		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	30588196	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	28000240		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28912897		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30524905		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23828443, 24764583, 25392179, 26317899, 27468881, 27531819, 28107186, 28160557, 28230773, 28377497, 28430626, 28465490, 28488168, 28848054, 28915924, 28936553, 29041905, 29053414, 29063313, 29104508, 29126881, 29212506, 29255938, 29263152, 29287242, 29291717, 29336717, 29387716, 29419531, 29438689, 29438695, 29464065, 29596308, 29615063, 29802358, 29808015, 29845474, 29933930, 29963107, 29996881, 30064200, 30066852, 30085937, 30111819, 30139555, 30221051, 30288049, 30294328, 30323975, 30345906, 30347025, 30429378, 30464002, 30474425, 30498230, 30635009, 30651729, 30653481, 30705400, 30728081, 30770442, 30915922, 30929569, 30949408, 30977385, 31090219, 31096176, 31106005, 31194225, 31196152, 31217296, 31349612, 31428520, 31473251, 31475003, 31505846, 31511565, 31564903, 31606656, 31612909, 31656319, 31722999, 31723167, 31751121, 31754897, 31786121, 31829043		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24764583, 27138582, 27286842, 27912781, 28107186, 28160557, 28230773, 28465490, 28984302, 29063313, 29104508, 29212506, 29291717, 29336717, 29387716, 29475913, 29615063, 29858752, 29933930, 29996881, 30064200, 30066852, 30085937, 30294328, 30475947, 30475950, 30576871, 30728081, 30753167, 30929569, 31473251, 31796994, 31936263, 32277627, 32311203, 32449246, 32574155, 32576238, 32612248, 32622323, 32681436, 32687248, 32709714, 32869930, 32954797, 33030848, 33239417, 33278935, 33289433, 33314633, 33503961, 33523034, 33523233, 33676425, 33717059, 33770313, 33918859, 33973887, 34105210, 34185141, 34219000, 34232604, 34253579, 34474671, 34530255, 34559865, 34583980, 34609409, 34732817, 34768219, 35085258, 35313339, 35337339, 35377046, 35380716, 35481432, 35622241, 35651625, 35694705, 35748713, 35845949, 36161312, 36165931, 36263619, 36295559, 36309362, 36385236, 36403210, 36404592, 36423363, 36432484, 36543379, 36581998, 36788078, 36866462, 36880837, 36945923, 37147986, 37201522, 37438720, 37441083, 37488704, 37489486, 37666492, 37671167, 37728465, 37792212, 37804360, 37817263, 37906592, 37924153, 37973901, 38125789, 38191648, 38212119, 38213050, 38267903, 39780116, 40362201, 40557143, 40612859, 40634657	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27900363, 33667790, 35268073, 40638667	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34131208	Inhibit	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	27158757, 27813511, 29053481, 30765880, 31370215, 32060377, 32857459, 33260328, 33603111, 34530255, 35773332, 36581850, 38022513	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	27629881, 27813511, 27984238, 28180998, 28351930, 28914717, 29053481, 29158190, 29489025, 29496294, 29523759, 29672836, 29673110, 29957683, 30112112, 30247204, 30277835, 30401949, 30519336, 30872332, 30931254, 31014354, 31069647, 31151482, 31205530, 31353229, 31370215, 31410780, 31417907, 31423245, 31666198, 31724072		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29910803		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	29750666	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17340590, 17686830, 24606459, 25733301, 27269937, 28912897, 29212506, 29271413, 29750666, 29941343, 30315148, 30400941, 30463956, 30666091, 31174611, 31267201, 31341011, 31655605, 31735557, 31996725, 32188412, 32221012, 32430334, 32497499, 32792852, 33356494, 33407095, 33770210, 33879103, 33909149, 34059019, 34104539, 34154613, 34244564, 34768978, 34776794, 34793662, 34819027, 34983384, 35013004, 35039462, 35209909, 35227680, 35314433, 35386697, 35710698, 35963646, 35967344, 35972693, 35999267, 36099881, 36275893, 36527880, 36861522, 37094985, 37151354, 37316699, 37379131, 37480214, 37543645, 37705121, 37955535, 38001512, 38071230, 38073378, 38186002, 38299148, 38384031, 38428685, 38556431, 39370312, 39867879, 40065444, 40596589	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Neoplasms	Urogenital neoplasm	Pubtator	33262136	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	32030476, 36397276, 38084519, 38423597, 39739128	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	27283319, 28409437, 28524003, 28668287, 28726535, 28861116, 29028766, 29103968, 29217732, 29260622, 29325739, 29407369, 29416316, 29750666, 30004857, 30062756, 30075156, 30182073, 30304985, 30464501, 30719168, 30776071, 30790015, 30851984, 30986253, 31040693, 31060469, 31125908, 31135485, 31190987, 31243779, 31356140, 31407099, 31607917, 31778799, 31837940		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23521696, 26624896, 33552075	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26403783	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	31191020		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26403783, 26431490, 27056074, 27721577, 28059093, 28075442, 28112728, 28623908, 29145543, 29212506, 30208866, 31274701, 31348579, 31586491, 31808707, 31924334, 32411801, 32493336, 32917410, 32964058, 33306195, 33424844, 33622931, 33632085, 33637877, 33972391, 34011535, 34076351, 34234252, 34449496, 34577118, 34606634, 34848831, 34994088, 35042477, 35139126, 35154907, 35535226, 36042498, 36091006, 36333792, 36430521, 36823665, 37083077, 37325638, 37378674, 37469254, 37818745, 37849747, 38193091, 38257813, 38295311, 39798703, 40141328, 40597137	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33388421	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29308311, 31009388		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	24658839, 36104728, 37221583	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18296654, 21461580, 28508938, 28680759, 29581543		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18296654, 28737763, 29185395, 29581543, 31960425, 33136179, 33203661, 33262254, 35341390, 39349498	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30821569, 31729418		★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	33574401	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27630241, 28848042, 29731774		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28848042, 29923081, 30446009, 30786844		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34625602	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	34625602	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	29923081		★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	28238417		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27192950, 29371688, 31096532		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	32430334	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27192950, 29371688, 31096532		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	27623354		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30104397		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	30104397, 40349989	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	18355839	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34519584	Stimulate	★☆☆☆☆ Found in Text Mining only