Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	29125
Gene name	Chromosome 11 open reading frame 21
Gene symbol	C11orf21
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11p15.5

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments
MIRT829401	hsa-miR-1205	CLIP-seq
MIRT829402	hsa-miR-1236	CLIP-seq
MIRT829403	hsa-miR-1257	CLIP-seq
MIRT829404	hsa-miR-125a-5p	CLIP-seq
MIRT829405	hsa-miR-125b	CLIP-seq
MIRT829406	hsa-miR-1266	CLIP-seq
MIRT829407	hsa-miR-1269	CLIP-seq
MIRT829408	hsa-miR-1269b	CLIP-seq
MIRT829409	hsa-miR-1288	CLIP-seq
MIRT829410	hsa-miR-134	CLIP-seq
MIRT829411	hsa-miR-1343	CLIP-seq
MIRT829412	hsa-miR-1587	CLIP-seq
MIRT829413	hsa-miR-183	CLIP-seq
MIRT829414	hsa-miR-31	CLIP-seq
MIRT829415	hsa-miR-3118	CLIP-seq
MIRT829416	hsa-miR-3164	CLIP-seq
MIRT829417	hsa-miR-3175	CLIP-seq
MIRT829418	hsa-miR-3184	CLIP-seq
MIRT829419	hsa-miR-34a	CLIP-seq
MIRT829420	hsa-miR-34c-5p	CLIP-seq
MIRT829421	hsa-miR-3616-3p	CLIP-seq
MIRT829422	hsa-miR-3652	CLIP-seq
MIRT829423	hsa-miR-3665	CLIP-seq
MIRT829424	hsa-miR-3667-3p	CLIP-seq
MIRT829425	hsa-miR-377	CLIP-seq
MIRT829426	hsa-miR-378	CLIP-seq
MIRT829427	hsa-miR-378b	CLIP-seq
MIRT829428	hsa-miR-378c	CLIP-seq
MIRT829429	hsa-miR-378d	CLIP-seq
MIRT829430	hsa-miR-378e	CLIP-seq
MIRT829431	hsa-miR-378f	CLIP-seq
MIRT829432	hsa-miR-378h	CLIP-seq
MIRT829433	hsa-miR-378i	CLIP-seq
MIRT829434	hsa-miR-422a	CLIP-seq
MIRT829435	hsa-miR-423-5p	CLIP-seq
MIRT829436	hsa-miR-4302	CLIP-seq
MIRT829437	hsa-miR-4319	CLIP-seq
MIRT829438	hsa-miR-4430	CLIP-seq
MIRT829439	hsa-miR-4455	CLIP-seq
MIRT829440	hsa-miR-4481	CLIP-seq
MIRT829441	hsa-miR-4488	CLIP-seq
MIRT829442	hsa-miR-4492	CLIP-seq
MIRT829443	hsa-miR-4498	CLIP-seq
MIRT829444	hsa-miR-449a	CLIP-seq
MIRT829445	hsa-miR-449b	CLIP-seq
MIRT829446	hsa-miR-4515	CLIP-seq
MIRT829447	hsa-miR-4518	CLIP-seq
MIRT829448	hsa-miR-4656	CLIP-seq
MIRT829449	hsa-miR-4675	CLIP-seq
MIRT829450	hsa-miR-4697-5p	CLIP-seq
MIRT829451	hsa-miR-4710	CLIP-seq
MIRT829452	hsa-miR-4721	CLIP-seq
MIRT829453	hsa-miR-4731-5p	CLIP-seq
MIRT829454	hsa-miR-4732-3p	CLIP-seq
MIRT829455	hsa-miR-4740-5p	CLIP-seq
MIRT829456	hsa-miR-4741	CLIP-seq
MIRT829457	hsa-miR-4745-5p	CLIP-seq
MIRT829458	hsa-miR-4765	CLIP-seq
MIRT829459	hsa-miR-4792	CLIP-seq
MIRT829460	hsa-miR-486-3p	CLIP-seq
MIRT829461	hsa-miR-512-3p	CLIP-seq
MIRT829462	hsa-miR-544b	CLIP-seq
MIRT829463	hsa-miR-545	CLIP-seq
MIRT829464	hsa-miR-604	CLIP-seq
MIRT829465	hsa-miR-609	CLIP-seq
MIRT829466	hsa-miR-637	CLIP-seq
MIRT829467	hsa-miR-647	CLIP-seq
MIRT829468	hsa-miR-657	CLIP-seq
MIRT829469	hsa-miR-670	CLIP-seq
MIRT829470	hsa-miR-762	CLIP-seq
MIRT829403	hsa-miR-1257	CLIP-seq
MIRT1945546	hsa-miR-4530	CLIP-seq
MIRT1945547	hsa-miR-4694-5p	CLIP-seq
MIRT829461	hsa-miR-512-3p	CLIP-seq
MIRT1945548	hsa-miR-766	CLIP-seq
MIRT829404	hsa-miR-125a-5p	CLIP-seq
MIRT829405	hsa-miR-125b	CLIP-seq
MIRT829406	hsa-miR-1266	CLIP-seq
MIRT2183906	hsa-miR-1299	CLIP-seq
MIRT2183907	hsa-miR-146b-3p	CLIP-seq
MIRT829412	hsa-miR-1587	CLIP-seq
MIRT2183908	hsa-miR-214	CLIP-seq
MIRT2183909	hsa-miR-30a	CLIP-seq
MIRT2183910	hsa-miR-30b	CLIP-seq
MIRT2183911	hsa-miR-30c	CLIP-seq
MIRT2183912	hsa-miR-30d	CLIP-seq
MIRT2183913	hsa-miR-30e	CLIP-seq
MIRT2183914	hsa-miR-3173-5p	CLIP-seq
MIRT2183915	hsa-miR-323b-3p	CLIP-seq
MIRT2183916	hsa-miR-3612	CLIP-seq
MIRT2183917	hsa-miR-3619-5p	CLIP-seq
MIRT829422	hsa-miR-3652	CLIP-seq
MIRT2183918	hsa-miR-3664-3p	CLIP-seq
MIRT829423	hsa-miR-3665	CLIP-seq
MIRT2183919	hsa-miR-3977	CLIP-seq
MIRT2183920	hsa-miR-4277	CLIP-seq
MIRT829436	hsa-miR-4302	CLIP-seq
MIRT829437	hsa-miR-4319	CLIP-seq
MIRT829438	hsa-miR-4430	CLIP-seq
MIRT2183921	hsa-miR-4443	CLIP-seq
MIRT829442	hsa-miR-4492	CLIP-seq
MIRT2183922	hsa-miR-4495	CLIP-seq
MIRT829443	hsa-miR-4498	CLIP-seq
MIRT829447	hsa-miR-4518	CLIP-seq
MIRT2183923	hsa-miR-4645-5p	CLIP-seq
MIRT829448	hsa-miR-4656	CLIP-seq
MIRT2183924	hsa-miR-4673	CLIP-seq
MIRT829449	hsa-miR-4675	CLIP-seq
MIRT2183925	hsa-miR-4690-3p	CLIP-seq
MIRT829456	hsa-miR-4741	CLIP-seq
MIRT2183926	hsa-miR-4782-5p	CLIP-seq
MIRT2183927	hsa-miR-485-5p	CLIP-seq
MIRT2183928	hsa-miR-516b	CLIP-seq
MIRT2183929	hsa-miR-578	CLIP-seq
MIRT2183930	hsa-miR-650	CLIP-seq
MIRT2183931	hsa-miR-761	CLIP-seq
MIRT829470	hsa-miR-762	CLIP-seq
MIRT2183932	hsa-miR-764	CLIP-seq
MIRT2183933	hsa-miR-874	CLIP-seq
MIRT2183934	hsa-miR-939	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA

MIM	HGNC	e!Ensembl
611033	13231	ENSG00000110665

Q9P2W6

Protein name

Uncharacterized protein C11orf21

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15399	DUF4620	20 → 132	Domain of unknown function (DUF4620)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed exclusively in heart.

Sequence

MGRTWCGMWRRRRPGRRSAVPRWPHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAA
AQPSAHGALVPPATAHEPVDHPALHWLACCCCLSLPGQLPLAIRLGWDLDLEAGPSSGKL
CPRARRWQPLPS

Sequence length

132

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	Pubtator	25180572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	11054561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	29064472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	23770605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	23770605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	26956414, 28165464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	GWASCAT_DG	29064472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	29064472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	26956414, 28165464		★★★★★ ★☆☆☆☆ Found in Text Mining only

C11orf21 (chromosome 11 open reading frame 21)