PYCARD (PYD and CARD domain containing)

Gene

• Entrez ID: 29108
• Gene name: PYD and CARD domain containing
• Gene symbol: PYCARD
• Synonyms (NCBI Gene): ASC, CARD5, TMS, TMS-1, TMS1
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle d

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022399	hsa-miR-124-3p	Microarray	18668037
MIRT650297	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT650296	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT650295	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650294	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650293	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650292	hsa-miR-4469	HITS-CLIP	23824327
MIRT650290	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650291	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650289	hsa-miR-1251-3p	HITS-CLIP	23824327
MIRT650288	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT650287	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650286	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650285	hsa-miR-548aw	HITS-CLIP	23824327
MIRT650284	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT650283	hsa-miR-527	HITS-CLIP	23824327
MIRT650282	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT519238	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT519237	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT519236	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT519235	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT519234	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT519233	hsa-miR-3975	PAR-CLIP	23446348
MIRT519232	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT519231	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT519230	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT519229	hsa-miR-3188	PAR-CLIP	23446348
MIRT519228	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT519227	hsa-miR-3135b	PAR-CLIP	23446348
MIRT519226	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT519225	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT519224	hsa-miR-765	PAR-CLIP	23446348
MIRT519223	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT519222	hsa-miR-3652	PAR-CLIP	23446348
MIRT519221	hsa-miR-4430	PAR-CLIP	23446348
MIRT519220	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT519219	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519217	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT519218	hsa-miR-1273e	PAR-CLIP	23446348
MIRT519216	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT650297	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT650296	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT650295	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650294	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650293	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650292	hsa-miR-4469	HITS-CLIP	23824327
MIRT650290	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650291	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650289	hsa-miR-1251-3p	HITS-CLIP	23824327
MIRT650288	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT650287	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650286	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650285	hsa-miR-548aw	HITS-CLIP	23824327
MIRT650284	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT650283	hsa-miR-527	HITS-CLIP	23824327
MIRT650282	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT519238	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT519237	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT519236	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT519235	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT519234	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT519233	hsa-miR-3975	PAR-CLIP	23446348
MIRT519232	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT519231	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT519230	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT519229	hsa-miR-3188	PAR-CLIP	23446348
MIRT519228	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT519227	hsa-miR-3135b	PAR-CLIP	23446348
MIRT519226	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT519225	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT519224	hsa-miR-765	PAR-CLIP	23446348
MIRT519223	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT519222	hsa-miR-3652	PAR-CLIP	23446348
MIRT519221	hsa-miR-4430	PAR-CLIP	23446348
MIRT519220	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT519219	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519217	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT519218	hsa-miR-1273e	PAR-CLIP	23446348
MIRT519216	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT2689188	hsa-miR-3163	CLIP-seq
MIRT2689189	hsa-miR-383	CLIP-seq
MIRT2689190	hsa-miR-568	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	23229815
GO:0000139	Component	Golgi membrane	IEA
GO:0001773	Process	Myeloid dendritic cell activation	IEA
GO:0001773	Process	Myeloid dendritic cell activation	IMP	22732093
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	24407287
GO:0002218	Process	Activation of innate immune response	IBA
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002221	Process	Pattern recognition receptor signaling pathway	NAS	21918512, 22258606, 29196474, 29247998
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002588	Process	Positive regulation of antigen processing and presentation of peptide antigen via MHC class II	IEA
GO:0002588	Process	Positive regulation of antigen processing and presentation of peptide antigen via MHC class II	ISS
GO:0002821	Process	Positive regulation of adaptive immune response	IMP	22732093
GO:0005138	Function	Interleukin-6 receptor binding	IPI	24407287
GO:0005515	Function	Protein binding	IPI	11498534, 11786556, 12019269, 12656673, 14730312, 15020601, 15030775, 17178784, 17418785, 17964261, 19158675, 19158676, 22286270, 24237704, 24407287, 24531343, 24630722, 25006247, 25277106, 25402006, 25416956, 25605870, 28229991, 28636595, 31421660, 34341353, 34589402, 38593810
GO:0005523	Function	Tropomyosin binding	IPI	24407287
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	NAS	28263976
GO:0005737	Component	Cytoplasm	IDA	14730312, 15030775, 19158679
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	12019269, 19158676, 24803432, 28263976
GO:0005739	Component	Mitochondrion	IDA	14730312
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	NAS	27911804
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10567338
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	NAS	12019269
GO:0007231	Process	Osmosensory signaling pathway	NAS	22981536
GO:0008385	Component	IkappaB kinase complex	IDA	12486103
GO:0008385	Component	IkappaB kinase complex	IEA
GO:0008385	Component	IkappaB kinase complex	TAS	12656673
GO:0009617	Process	Response to bacterium	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IMP	14730312
GO:0016020	Component	Membrane	IEA
GO:0017024	Function	Myosin I binding	IPI	24407287
GO:0019899	Function	Enzyme binding	IPI	24407287
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	16585594
GO:0032090	Function	Pyrin domain binding	IPI	15030775
GO:0032688	Process	Negative regulation of interferon-beta production	IMP	19158675
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IMP	21487011
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	7642516, 15030775, 16037825, 24630722
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	22267217
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISO
GO:0032731	Process	Positive regulation of interleukin-1 beta production	NAS	21918512
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	16982856
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	16982856
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16982856
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16982856, 21487011
GO:0032991	Component	Protein-containing complex	IDA	22267217
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	12656673
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	ISS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	14730312
GO:0042802	Function	Identical protein binding	IDA	34341353
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	24630722, 25006247, 25416956
GO:0042803	Function	Protein homodimerization activity	IDA	15030775
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12646168
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	12656673
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	12486103
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044351	Process	Macropinocytosis	IEA
GO:0044351	Process	Macropinocytosis	ISS
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	27432880
GO:0045087	Process	Innate immune response	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	21487011
GO:0046456	Process	Icosanoid biosynthetic process	NAS	22902502
GO:0046983	Function	Protein dimerization activity	IDA	24531343
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	21575908
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12191486
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISO
GO:0050729	Process	Positive regulation of inflammatory response	NAS	21918512, 24630722, 29255148
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	16982856, 21487011
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	IMP	22732093
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	19494289
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12646168
GO:0051260	Process	Protein homooligomerization	IDA	24531343
GO:0051260	Process	Protein homooligomerization	IEA
GO:0051607	Process	Defense response to virus	IDA	21575908
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	NAS	28314590
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0061702	Component	Canonical inflammasome complex	IEA
GO:0061702	Component	Canonical inflammasome complex	IPI	16037825
GO:0061702	Component	Canonical inflammasome complex	NAS	25879286
GO:0070269	Process	Pyroptotic inflammatory response	NAS	19158676, 26121197, 26611636, 29196474
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21487011
GO:0070700	Function	BMP receptor binding	IPI	24407287
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12486103
GO:0071347	Process	Cellular response to interleukin-1	IDA	12486103
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	12486103
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IDA	12486103
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	14730312
GO:0072558	Component	NLRP1 inflammasome complex	IDA	12191486
GO:0072558	Component	NLRP1 inflammasome complex	IEA
GO:0072558	Component	NLRP1 inflammasome complex	IPI	17349957
GO:0072559	Component	NLRP3 inflammasome complex	IBA
GO:0072559	Component	NLRP3 inflammasome complex	IDA	15030775
GO:0072559	Component	NLRP3 inflammasome complex	IPI	29255148
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	14730312
GO:0097169	Component	AIM2 inflammasome complex	IDA	19158676
GO:0097169	Component	AIM2 inflammasome complex	IPI	24630722
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IBA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	NAS	12019269
GO:0140632	Process	Canonical inflammasome complex assembly	IEA
GO:0140738	Component	NLRP6 inflammasome complex	IDA	30674671, 34678144
GO:0140738	Component	NLRP6 inflammasome complex	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IMP	24531343
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IPI	15817483
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	ISS
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	16964285
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IDA	14730312

Other IDs

• MIM: 606838
• HGNC: 16608
• e!Ensembl: ENSG00000103490

Protein

• UniProt ID: Q9ULZ3
• Protein name: Apoptosis-associated speck-like protein containing a CARD (hASC) (Caspase recruitment domain-containing protein 5) (PYD and CARD domain-containing protein) (Target of methylation-induced silencing 1)
• Protein function: Functions as a key mediator in apoptosis and inflammation (PubMed:11103777, PubMed:12646168, PubMed:15030775, PubMed:17349957, PubMed:17599095, PubMed:19158675, PubMed:19158676, PubMed:19234215, PubMed:19494289, PubMed:21487011, PubMed:24630722,
• PDB: 1UCP, 2KN6, 3J63, 5H8O, 6K99, 6KI0, 6N1H, 7E5B, 7KEU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02758	PYRIN	7 → 83	PAAD/DAPIN/Pyrin domain	Domain
  PF00619	CARD	112 → 195	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Expressed
• Sequence:

  MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
  LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
  ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
  LRESQSYLVEDLERS

• Sequence length: 195

Pathways

KEGG:

Necroptosis
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
C-type lectin receptor signaling pathway
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Yersinia infection
Influenza A
Lipid and atherosclerosis

Reactome:

CLEC7A/inflammasome pathway
Neutrophil degranulation
The NLRP3 inflammasome
Purinergic signaling in leishmaniasis infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, LARGE CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SMALL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERHOMOCYSTEINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16778195, 19689463, 23065574, 24603303		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17986858		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17986858		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26939933	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	18791131, 29293211, 29634349		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	23452957, 29854761		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	31069759		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31576130		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31576130		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31151157		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24618883	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24618883		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24688120		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20177071		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26385789	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33162829, 37659984	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30544130		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39270557	Associate	★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	BEFREE	28787517		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15466382		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21339190	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24688120		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29052806		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29138856		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23633568		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25432062		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30575805	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26264279, 31234917		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	30909283		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	30596792	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28050345, 30927156, 31297597		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11880707, 12800194, 14643031, 19223547, 19661336, 28475015		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11733524, 15466382, 19324871, 19789341, 20716965, 31086376	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19223547, 21321083	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38031068	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25004838, 33628338	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17986858		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26264279, 31234917		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16778195		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27768771, 33637109, 36355420	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	14720325, 15041718, 30986993		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29635028, 30038562, 31216943		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17355305, 19258216, 23010706		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	17091508, 19901435, 22808295, 23881840		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17355305, 19258216, 20116836, 23010706		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16911948, 22230750		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22230750	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	29901555, 31069759		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	26457439		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29241624, 29948504, 30057487		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	26457439		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	22828789, 30422379		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22828789	Associate	★☆☆☆☆ Found in Text Mining only
Chronic recurrent multifocal osteomyelitis	Recurrent multifocal osteomyelitis	Pubtator	25061439	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	22266243, 31069759		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27647858, 29088461, 30726894		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14643031, 16331272, 17986858		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17986858		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14643031, 17986858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17986858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17986858	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	26700661, 28072632		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26093088		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	24952504		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	29086221		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31532390		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15498798, 29803179, 31119302		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31155302		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28420271, 30328957, 30674902		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	36736455	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36099092	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23086037	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28447181, 29508169, 29588192, 30422379, 31467560		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28447181		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29508169		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19239430		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	22003197		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	31665908		★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	28007469		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	14720325, 30986993		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	40295580	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	26818951		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	39350187	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30103942		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28056049		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	15961108		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	28367892	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15094455, 15466382, 17048097		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15466382	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17048097		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15094455, 15466382, 17048097		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21339190	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26700661, 28072632		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28072632	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25798846	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28947119, 29660633		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	30649347		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	CTD_human_DG	22647887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	31770592, 39343901	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	3116328		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	26306997		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31069759		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35578687	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29443417		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	20607682		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	10951465, 28270858		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	22647887, 24508291		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	30922667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Language Disorders	Language Disorders	BEFREE	29052806		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31312615		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14634131		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24528084	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25583238, 32751923, 37367830	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17471463, 27668844		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	17471463		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22266243, 31069759		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16778195		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	29459573	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20532967		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36610524	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32883954	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29551295		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	15897551		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33364081	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30674902, 31631058		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15094455		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	26935421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11103776, 11880707, 12776200, 12800194, 12949795, 14643031, 19223547, 19661336, 28475015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26093088		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16778195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	14720325, 15041718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21036703		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16425203, 16848908, 21912429, 22831834, 23104178, 23219429, 25432062, 27045473, 28323036, 28528814, 29425687, 30692044		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12553049, 17943730, 26260914		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20926535		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26264279, 31234917		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12553049, 14720325, 15466382, 16911948, 17471463, 17805543, 17986858, 18701507, 18847555, 22230750, 23047626, 30072146, 30383496, 30738816		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17355305, 19258216, 23010706		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11103776, 12800194, 17599361		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12800194, 15466382		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	12949795		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12949795, 22931929, 27869170		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12949795		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36068291	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	26822489		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28420271, 30328957, 30674902		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31705513		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26044878		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30172756		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	22931929		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30462312		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22429346	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28148962		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	34193364	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	29780394	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sulfatase Deficiency Disease	Multiple Sulfatase Deficiency	BEFREE	3116328		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30072146		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30072146	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	30072146		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22869553	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12800194, 14643031, 15316056, 15466382, 15897551, 16425203, 16435073, 16848908, 16870048, 17048097, 17272309, 17471463, 17943730, 17986858, 19661336, 19789341, 20564325, 20716965, 20833385, 20926535, 22808295, 22831834, 24603303, 26093088, 29132873, 30334568, 30393160, 30986993		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	29241624		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30846765, 31720969		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	30977509		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21104989		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31155302, 31378601		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11880707, 12800194, 16778195, 16870048, 24603303		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	19223547		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	19223547		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30473213		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29588192, 30276973, 31379826		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	28474552, 28927961		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30922413, 37853066	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	28927961		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30422379		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	24652041, 30676848		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	31821259		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14720325, 15041718		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21036703		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	20926535		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	15584047		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29373395		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31915018	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31155302		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31316105		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30649347		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31155302		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30072146		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29901555, 31069759		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	31155302, 31378601		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16425203, 16848908, 21912429, 22831834, 23219429, 25432062, 27045473, 28323036, 28528814, 29425687, 30692044		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16425203, 16848908		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16848908, 26036629, 28663562, 33628338	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30473213		★☆☆☆☆ Found in Text Mining only
Quadriplegia	Quadriplegia	BEFREE	28635523		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26093088		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26093088		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30057487		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32265920	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	29773202		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29067740		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	31606551	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15498798, 20532967, 31119302		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30032068, 30409696		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23906036	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12800194, 16435073		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	12800194		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	16778195		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30261268		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33637109	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26044878		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12553049, 17943730, 26260914		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12553049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34686215	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	39394477	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20926535		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20926535		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28145409		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19258216	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30941060		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28148962		★☆☆☆☆ Found in Text Mining only