SCG3 (secretogranin III)

Gene

• Entrez ID: 29106
• Gene name: Secretogranin III
• Gene symbol: SCG3
• Synonyms (NCBI Gene): SGIII
• Chromosome: 15
• Chromosome location: 15q21.2
• Summary: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in so

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017386	hsa-miR-335-5p	Microarray	18185580
MIRT1329318	hsa-miR-4466	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT1329322	hsa-miR-675	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT1329324	hsa-miR-1305	CLIP-seq
MIRT1329325	hsa-miR-2115	CLIP-seq
MIRT1329326	hsa-miR-3119	CLIP-seq
MIRT1329327	hsa-miR-3188	CLIP-seq
MIRT1329328	hsa-miR-330-3p	CLIP-seq
MIRT1329329	hsa-miR-3692	CLIP-seq
MIRT1329318	hsa-miR-4466	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT1329330	hsa-miR-539	CLIP-seq
MIRT1329331	hsa-miR-548p	CLIP-seq
MIRT1329332	hsa-miR-580	CLIP-seq
MIRT1329333	hsa-miR-607	CLIP-seq
MIRT1329322	hsa-miR-675	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT1329334	hsa-miR-877	CLIP-seq
MIRT1329335	hsa-miR-885-5p	CLIP-seq
MIRT2097663	hsa-miR-1207-3p	CLIP-seq
MIRT2097664	hsa-miR-412	CLIP-seq
MIRT2097665	hsa-miR-4267	CLIP-seq
MIRT2097666	hsa-miR-4691-5p	CLIP-seq
MIRT1329319	hsa-miR-4797-5p	CLIP-seq
MIRT1329320	hsa-miR-509-3p	CLIP-seq
MIRT1329321	hsa-miR-512-3p	CLIP-seq
MIRT2097667	hsa-miR-551a	CLIP-seq
MIRT2097668	hsa-miR-551b	CLIP-seq
MIRT1329323	hsa-miR-759	CLIP-seq
MIRT2618356	hsa-miR-1254	CLIP-seq
MIRT2618357	hsa-miR-1267	CLIP-seq
MIRT2618358	hsa-miR-1291	CLIP-seq
MIRT2618359	hsa-miR-3116	CLIP-seq
MIRT2618360	hsa-miR-3121-5p	CLIP-seq
MIRT2618361	hsa-miR-328	CLIP-seq
MIRT2618362	hsa-miR-661	CLIP-seq
MIRT2618356	hsa-miR-1254	CLIP-seq
MIRT2618357	hsa-miR-1267	CLIP-seq
MIRT2618358	hsa-miR-1291	CLIP-seq
MIRT2618359	hsa-miR-3116	CLIP-seq
MIRT2618360	hsa-miR-3121-5p	CLIP-seq
MIRT2618361	hsa-miR-328	CLIP-seq
MIRT2618362	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
REST	Unknown	19118055

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	19357184, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0016020	Component	Membrane	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IBA
GO:0030667	Component	Secretory granule membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033366	Process	Protein localization to secretory granule	IBA
GO:0033366	Process	Protein localization to secretory granule	IEA
GO:0034774	Component	Secretory granule lumen	TAS

Other IDs

• MIM: 611796
• HGNC: 13707
• e!Ensembl: ENSG00000104112

Protein

• UniProt ID: Q8WXD2
• Protein name: Secretogranin-3 (Secretogranin III) (SgIII)
• Protein function: Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:19357184). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity). May also play a role in angiogenesis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15467	SGIII	17 → 468	Secretogranin-3	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in urine (at protein level) (PubMed:25326458). Expressed in brain, heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:12098761, ECO:0000269|PubMed:25326458}.
• Sequence:

  MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPP
  ENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDY
  DSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGL
  ITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGL
  AKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLI
  TIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSE
  KSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK
  KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

• Sequence length: 468

Pathways

Reactome:

Platelet degranulation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	29050227		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	7680355		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14630798	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28949141		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28330905, 28856381		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34257545	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34257545	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	7680355		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	34360799	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30298961		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33952317	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28949141		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21796137	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21796137, 31514320		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23889332		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32396724	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17200173, 21796137		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33983957	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	7680355		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22987761		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32404559	Inhibit	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29050227		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28330905, 28856381, 30633921, 30644010		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28330905, 30644010		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28949141		★☆☆☆☆ Found in Text Mining only