Gene Gene information from NCBI Gene database.
Entrez ID 29103
Gene name DnaJ heat shock protein family (Hsp40) member C15
Gene symbol DNAJC15
Synonyms (NCBI Gene)
DNAJD1HSD18MCJ
Chromosome 13
Chromosome location 13q14.11
miRNA miRNA information provided by mirtarbase database.
258
miRTarBase ID miRNA Experiments Reference
MIRT031683 hsa-miR-16-5p Proteomics 18668040
MIRT606986 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT688452 hsa-miR-450b-5p HITS-CLIP 23313552
MIRT688451 hsa-miR-507 HITS-CLIP 23313552
MIRT688450 hsa-miR-557 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0001405 Component PAM complex, Tim23 associated import motor IBA
GO:0001671 Function ATPase activator activity IBA
GO:0005515 Function Protein binding IPI 23263864, 25416956, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615339 20325 ENSG00000120675
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5T4
Protein name DnaJ homolog subfamily C member 15 (Cell growth-inhibiting gene 22 protein) (Methylation-controlled J protein) (MCJ)
Protein function Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in heart, followed by liver and kidney. {ECO:0000269|PubMed:11358853, ECO:0000269|PubMed:23530063}.
Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRI
WKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVM
ILNHPDKGGSPYVAAKINEAKDLLETTTKH
Sequence length 150
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OBESITY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Medulloblastoma Medulloblastoma BEFREE 16049974
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 27330077 Associate
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 16049974
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 17283040, 30025229
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25809865, 30025229 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 11358853, 14729589, 15894365
★☆☆☆☆
Found in Text Mining only
Childhood Medulloblastoma Medulloblastoma BEFREE 16049974
★☆☆☆☆
Found in Text Mining only
Ependymoma Ependymoma BEFREE 16049974
★☆☆☆☆
Found in Text Mining only
Ependymoma Ependymoma LHGDN 16049974
★☆☆☆☆
Found in Text Mining only
Epithelial ovarian cancer Ovarian cancer BEFREE 15894365
★☆☆☆☆
Found in Text Mining only