Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2908
Gene name	Nuclear receptor subfamily 3 group C member 1
Gene symbol	NR3C1
Synonyms (NCBI Gene)	GCCRGCRGCRSTGRGRL
Chromosome	5
Chromosome location	5q31.3
Summary	This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other tr

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6189	C>A,T	Benign-likely-benign, pathogenic	Genic upstream transcript variant, 5 prime UTR variant, upstream transcript variant, missense variant, coding sequence variant, intron variant, synonymous variant
rs104893908	T>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893909	A>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893910	A>C,G	Pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant, synonymous variant, genic downstream transcript variant
rs104893911	A>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893912	A>G	Pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant
rs104893913	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs104893914	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs121909726	T>A	Pathogenic	Intron variant, coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
rs121909727	A>G	Pathogenic	Intron variant, coding sequence variant, missense variant, non coding transcript variant, genic downstream transcript variant
rs587776832	CTCA>-	Pathogenic	Non coding transcript variant, coding sequence variant, splice donor variant

661

Show/Hide all (661)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assay	19131573
MIRT004546	hsa-miR-124-3p	Luciferase reporter assay	19131573
MIRT004545	hsa-miR-18a-5p	Western blot	19131573
MIRT004546	hsa-miR-124-3p	Western blot	19131573
MIRT004545	hsa-miR-18a-5p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	pMIR-REPORT	19131573
MIRT004546	hsa-miR-124-3p	Luciferase reporter assayNorthern blotWestern blot	19131573
MIRT016193	hsa-miR-590-3p	Sequencing	20371350
MIRT020164	hsa-miR-130b-3p	Sequencing	20371350
MIRT020725	hsa-miR-155-5p	Proteomics	18668040
MIRT004546	hsa-miR-124-3p	Microarray	18668037
MIRT028300	hsa-miR-32-5p	Sequencing	20371350
MIRT030650	hsa-miR-22-3p	Sequencing	20371350
MIRT031124	hsa-miR-19b-3p	Sequencing	20371350
MIRT039437	hsa-miR-421	CLASH	23622248
MIRT687449	hsa-miR-138-5p	HITS-CLIP	23313552
MIRT687448	hsa-miR-137	HITS-CLIP	23313552
MIRT095604	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT687447	hsa-miR-6800-3p	HITS-CLIP	23313552
MIRT214865	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT095600	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT687446	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT095597	hsa-miR-1279	HITS-CLIP	23313552
MIRT687445	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT687444	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT687443	hsa-miR-3182	HITS-CLIP	23313552
MIRT687442	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT687441	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT687440	hsa-miR-5186	HITS-CLIP	23313552
MIRT687439	hsa-miR-133a-5p	HITS-CLIP	23313552
MIRT687438	hsa-miR-6131	HITS-CLIP	23313552
MIRT687437	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT687436	hsa-miR-496	HITS-CLIP	23313552
MIRT687435	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT687434	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT391240	hsa-miR-192-3p	HITS-CLIP	23313552
MIRT687433	hsa-miR-1263	HITS-CLIP	23313552
MIRT687432	hsa-miR-544a	HITS-CLIP	23313552
MIRT687431	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT687430	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT687429	hsa-miR-6868-3p	HITS-CLIP	23313552
MIRT566613	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT440092	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT566612	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT312331	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT566611	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT566610	hsa-miR-1179	PAR-CLIP	20371350
MIRT214857	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT566609	hsa-miR-5692b	PAR-CLIP	20371350
MIRT566608	hsa-miR-5692c	PAR-CLIP	20371350
MIRT329361	hsa-miR-4528	PAR-CLIP	20371350
MIRT095611	hsa-miR-4672	PAR-CLIP	20371350
MIRT566607	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT095612	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT566606	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT566605	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT566604	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT378074	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT214899	hsa-miR-618	PAR-CLIP	21572407
MIRT555970	hsa-miR-6757-5p	PAR-CLIP	21572407
MIRT555969	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT555968	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT555967	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555966	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555964	hsa-miR-3162-5p	PAR-CLIP	21572407
MIRT471981	hsa-miR-4282	PAR-CLIP	23592263
MIRT471980	hsa-miR-8485	PAR-CLIP	23592263
MIRT471979	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT471978	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT471977	hsa-miR-603	PAR-CLIP	23592263
MIRT471976	hsa-miR-5582-5p	PAR-CLIP	23592263
MIRT471975	hsa-miR-3622a-5p	PAR-CLIP	23592263
MIRT471974	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT471973	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT471972	hsa-miR-125b-1-3p	PAR-CLIP	23592263
MIRT471971	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT095609	hsa-miR-3941	PAR-CLIP	23592263
MIRT095608	hsa-miR-466	PAR-CLIP	23592263
MIRT471970	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT471969	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT471968	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT440092	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT440091	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT440092	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT440091	hsa-miR-377-3p	HITS-CLIP	24374217
MIRT020164	hsa-miR-130b-3p	qRT-PCRWestern blot	26475357
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assayWestern blot	27888798
MIRT004545	hsa-miR-18a-5p	Luciferase reporter assayWestern blot	27888798
MIRT566612	hsa-miR-144-3p	Luciferase reporter assayqRT-PCR	32835083
MIRT733239	hsa-miR-126-3p	Immunohistochemistry (IHC)In situ hybridizationMicroarray	34055877
MIRT733240	hsa-miR-20b-3p	Immunohistochemistry (IHC)In situ hybridizationMicroarray	34055877
MIRT391240	hsa-miR-192-3p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	33134908
MIRT687449	hsa-miR-138-5p	HITS-CLIP	23313552
MIRT687448	hsa-miR-137	HITS-CLIP	23313552
MIRT095604	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT687447	hsa-miR-6800-3p	HITS-CLIP	23313552
MIRT214865	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT095600	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT687446	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT095597	hsa-miR-1279	HITS-CLIP	23313552
MIRT687445	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT687444	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT687443	hsa-miR-3182	HITS-CLIP	23313552
MIRT687442	hsa-miR-3928-5p	HITS-CLIP	23313552
MIRT687441	hsa-miR-6806-3p	HITS-CLIP	23313552
MIRT687440	hsa-miR-5186	HITS-CLIP	23313552
MIRT687439	hsa-miR-133a-5p	HITS-CLIP	23313552
MIRT687438	hsa-miR-6131	HITS-CLIP	23313552
MIRT687437	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT687436	hsa-miR-496	HITS-CLIP	23313552
MIRT687435	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT687434	hsa-miR-127-5p	HITS-CLIP	23313552
MIRT391240	hsa-miR-192-3p	HITS-CLIP	23313552
MIRT687433	hsa-miR-1263	HITS-CLIP	23313552
MIRT687432	hsa-miR-544a	HITS-CLIP	23313552
MIRT687431	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT687430	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT687429	hsa-miR-6868-3p	HITS-CLIP	23313552
MIRT566613	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT440092	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT566612	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT312331	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT566611	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT566610	hsa-miR-1179	PAR-CLIP	20371350
MIRT214857	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT566609	hsa-miR-5692b	PAR-CLIP	20371350
MIRT566608	hsa-miR-5692c	PAR-CLIP	20371350
MIRT329361	hsa-miR-4528	PAR-CLIP	20371350
MIRT095611	hsa-miR-4672	PAR-CLIP	20371350
MIRT566607	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT095612	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT566606	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT566605	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT566604	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT378074	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT214899	hsa-miR-618	PAR-CLIP	21572407
MIRT555970	hsa-miR-6757-5p	PAR-CLIP	21572407
MIRT555969	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT555968	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT555967	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555966	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555964	hsa-miR-3162-5p	PAR-CLIP	21572407
MIRT471981	hsa-miR-4282	PAR-CLIP	23592263
MIRT471980	hsa-miR-8485	PAR-CLIP	23592263
MIRT471979	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT471978	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT471977	hsa-miR-603	PAR-CLIP	23592263
MIRT471976	hsa-miR-5582-5p	PAR-CLIP	23592263
MIRT471975	hsa-miR-3622a-5p	PAR-CLIP	23592263
MIRT471974	hsa-miR-5586-5p	PAR-CLIP	23592263
MIRT471973	hsa-miR-6849-3p	PAR-CLIP	23592263
MIRT471972	hsa-miR-125b-1-3p	PAR-CLIP	23592263
MIRT471971	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT095609	hsa-miR-3941	PAR-CLIP	23592263
MIRT095608	hsa-miR-466	PAR-CLIP	23592263
MIRT471970	hsa-miR-4423-3p	PAR-CLIP	23592263
MIRT471969	hsa-miR-6512-3p	PAR-CLIP	23592263
MIRT471968	hsa-miR-6720-5p	PAR-CLIP	23592263
MIRT004546	hsa-miR-124-3p	Luciferase reporter assayWestern blottingqRT-PCR	35270010
MIRT1192606	hsa-miR-144	CLIP-seq
MIRT1192607	hsa-miR-3143	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192609	hsa-miR-365	CLIP-seq
MIRT1192610	hsa-miR-374a	CLIP-seq
MIRT1192611	hsa-miR-374b	CLIP-seq
MIRT1192612	hsa-miR-4694-3p	CLIP-seq
MIRT1192613	hsa-miR-4718	CLIP-seq
MIRT1192614	hsa-miR-522	CLIP-seq
MIRT1192615	hsa-miR-543	CLIP-seq
MIRT1192616	hsa-miR-1207-3p	CLIP-seq
MIRT1192617	hsa-miR-1231	CLIP-seq
MIRT1192618	hsa-miR-1258	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT1192620	hsa-miR-1299	CLIP-seq
MIRT1192621	hsa-miR-1303	CLIP-seq
MIRT1192622	hsa-miR-1305	CLIP-seq
MIRT1192623	hsa-miR-150	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192628	hsa-miR-197	CLIP-seq
MIRT1192629	hsa-miR-204	CLIP-seq
MIRT1192630	hsa-miR-2053	CLIP-seq
MIRT1192631	hsa-miR-211	CLIP-seq
MIRT1192632	hsa-miR-30a	CLIP-seq
MIRT1192633	hsa-miR-30b	CLIP-seq
MIRT1192634	hsa-miR-30c	CLIP-seq
MIRT1192635	hsa-miR-30d	CLIP-seq
MIRT1192636	hsa-miR-30e	CLIP-seq
MIRT1192637	hsa-miR-3117-3p	CLIP-seq
MIRT1192638	hsa-miR-3122	CLIP-seq
MIRT1192639	hsa-miR-3125	CLIP-seq
MIRT1192640	hsa-miR-3126-3p	CLIP-seq
MIRT1192641	hsa-miR-3129-3p	CLIP-seq
MIRT1192642	hsa-miR-3153	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT1192644	hsa-miR-3169	CLIP-seq
MIRT1192645	hsa-miR-3185	CLIP-seq
MIRT1192646	hsa-miR-3192	CLIP-seq
MIRT1192647	hsa-miR-3200-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192649	hsa-miR-3662	CLIP-seq
MIRT1192650	hsa-miR-3913-5p	CLIP-seq
MIRT1192651	hsa-miR-3916	CLIP-seq
MIRT1192652	hsa-miR-3920	CLIP-seq
MIRT1192653	hsa-miR-409-3p	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT1192656	hsa-miR-4288	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192658	hsa-miR-4314	CLIP-seq
MIRT1192659	hsa-miR-433	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT1192661	hsa-miR-4517	CLIP-seq
MIRT1192662	hsa-miR-4646-5p	CLIP-seq
MIRT1192663	hsa-miR-4668-5p	CLIP-seq
MIRT1192664	hsa-miR-4709-5p	CLIP-seq
MIRT1192665	hsa-miR-4712-3p	CLIP-seq
MIRT1192666	hsa-miR-4713-5p	CLIP-seq
MIRT1192667	hsa-miR-4735-5p	CLIP-seq
MIRT1192668	hsa-miR-4738-3p	CLIP-seq
MIRT1192669	hsa-miR-4759	CLIP-seq
MIRT1192670	hsa-miR-4762-3p	CLIP-seq
MIRT1192671	hsa-miR-4766-5p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT1192674	hsa-miR-485-3p	CLIP-seq
MIRT1192675	hsa-miR-507	CLIP-seq
MIRT1192676	hsa-miR-5096	CLIP-seq
MIRT1192677	hsa-miR-513a-3p	CLIP-seq
MIRT1192678	hsa-miR-532-3p	CLIP-seq
MIRT1192679	hsa-miR-544	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT1192683	hsa-miR-557	CLIP-seq
MIRT1192684	hsa-miR-569	CLIP-seq
MIRT1192685	hsa-miR-587	CLIP-seq
MIRT1192686	hsa-miR-632	CLIP-seq
MIRT1192687	hsa-miR-656	CLIP-seq
MIRT1192688	hsa-miR-875-3p	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT1192692	hsa-miR-1225-5p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT1192695	hsa-miR-1275	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT1192621	hsa-miR-1303	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT1192704	hsa-miR-297	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192639	hsa-miR-3125	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT1192707	hsa-miR-3174	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192710	hsa-miR-3591-5p	CLIP-seq
MIRT1192711	hsa-miR-3606	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192651	hsa-miR-3916	CLIP-seq
MIRT1192719	hsa-miR-4272	CLIP-seq
MIRT1192720	hsa-miR-4422	CLIP-seq
MIRT1192721	hsa-miR-4436a	CLIP-seq
MIRT1192722	hsa-miR-4446-3p	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT1192724	hsa-miR-4501	CLIP-seq
MIRT1192725	hsa-miR-4525	CLIP-seq
MIRT1192726	hsa-miR-4659a-5p	CLIP-seq
MIRT1192727	hsa-miR-4659b-5p	CLIP-seq
MIRT1192728	hsa-miR-4665-5p	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192730	hsa-miR-4675	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT1192732	hsa-miR-4721	CLIP-seq
MIRT1192733	hsa-miR-4723-5p	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT1192735	hsa-miR-4731-5p	CLIP-seq
MIRT1192736	hsa-miR-4741	CLIP-seq
MIRT1192737	hsa-miR-4776-3p	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT1192738	hsa-miR-548a-5p	CLIP-seq
MIRT1192739	hsa-miR-548ab	CLIP-seq
MIRT1192740	hsa-miR-548ak	CLIP-seq
MIRT1192741	hsa-miR-548b-5p	CLIP-seq
MIRT1192742	hsa-miR-548c-5p	CLIP-seq
MIRT1192743	hsa-miR-548d-5p	CLIP-seq
MIRT1192744	hsa-miR-548h	CLIP-seq
MIRT1192745	hsa-miR-548i	CLIP-seq
MIRT1192746	hsa-miR-548j	CLIP-seq
MIRT1192747	hsa-miR-548w	CLIP-seq
MIRT1192748	hsa-miR-548y	CLIP-seq
MIRT1192749	hsa-miR-555	CLIP-seq
MIRT1192750	hsa-miR-559	CLIP-seq
MIRT1192751	hsa-miR-561	CLIP-seq
MIRT1192752	hsa-miR-567	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT1192755	hsa-miR-616	CLIP-seq
MIRT1192756	hsa-miR-625	CLIP-seq
MIRT1192757	hsa-miR-637	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT1192759	hsa-miR-921	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2055944	hsa-miR-1224-5p	CLIP-seq
MIRT1192692	hsa-miR-1225-5p	CLIP-seq
MIRT1192618	hsa-miR-1258	CLIP-seq
MIRT2055945	hsa-miR-1284	CLIP-seq
MIRT2055946	hsa-miR-1304	CLIP-seq
MIRT2055947	hsa-miR-200b	CLIP-seq
MIRT2055948	hsa-miR-200c	CLIP-seq
MIRT1192637	hsa-miR-3117-3p	CLIP-seq
MIRT2055949	hsa-miR-3150b-3p	CLIP-seq
MIRT1192644	hsa-miR-3169	CLIP-seq
MIRT2055950	hsa-miR-3654	CLIP-seq
MIRT2055951	hsa-miR-3668	CLIP-seq
MIRT2055952	hsa-miR-378	CLIP-seq
MIRT2055953	hsa-miR-378b	CLIP-seq
MIRT2055954	hsa-miR-378c	CLIP-seq
MIRT2055955	hsa-miR-378d	CLIP-seq
MIRT2055956	hsa-miR-378e	CLIP-seq
MIRT2055957	hsa-miR-378f	CLIP-seq
MIRT2055958	hsa-miR-378h	CLIP-seq
MIRT2055959	hsa-miR-378i	CLIP-seq
MIRT2055960	hsa-miR-3907	CLIP-seq
MIRT2055961	hsa-miR-3915	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT2055962	hsa-miR-422a	CLIP-seq
MIRT2055963	hsa-miR-429	CLIP-seq
MIRT2055964	hsa-miR-4503	CLIP-seq
MIRT2055965	hsa-miR-4689	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT1192669	hsa-miR-4759	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2055967	hsa-miR-4779	CLIP-seq
MIRT2055968	hsa-miR-4784	CLIP-seq
MIRT2055969	hsa-miR-515-5p	CLIP-seq
MIRT1192749	hsa-miR-555	CLIP-seq
MIRT1192751	hsa-miR-561	CLIP-seq
MIRT2055970	hsa-miR-606	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT2055945	hsa-miR-1284	CLIP-seq
MIRT1192622	hsa-miR-1305	CLIP-seq
MIRT2055971	hsa-miR-1324	CLIP-seq
MIRT2055972	hsa-miR-142-5p	CLIP-seq
MIRT2055973	hsa-miR-29a	CLIP-seq
MIRT2055974	hsa-miR-29b	CLIP-seq
MIRT2055975	hsa-miR-29c	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT2055976	hsa-miR-340	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT2055977	hsa-miR-4328	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2055978	hsa-miR-4433	CLIP-seq
MIRT2055979	hsa-miR-4435	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192670	hsa-miR-4762-3p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT2055982	hsa-miR-548aa	CLIP-seq
MIRT2055983	hsa-miR-548s	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT2055973	hsa-miR-29a	CLIP-seq
MIRT2055974	hsa-miR-29b	CLIP-seq
MIRT2055975	hsa-miR-29c	CLIP-seq
MIRT2284662	hsa-miR-3689a-5p	CLIP-seq
MIRT2284663	hsa-miR-3689b	CLIP-seq
MIRT2284664	hsa-miR-3689e	CLIP-seq
MIRT2284665	hsa-miR-3689f	CLIP-seq
MIRT2284666	hsa-miR-4318	CLIP-seq
MIRT2284667	hsa-miR-4425	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2055979	hsa-miR-4435	CLIP-seq
MIRT2284669	hsa-miR-450b-3p	CLIP-seq
MIRT2284670	hsa-miR-4679	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT2284672	hsa-miR-4693-5p	CLIP-seq
MIRT1192672	hsa-miR-4775	CLIP-seq
MIRT2284673	hsa-miR-4789-3p	CLIP-seq
MIRT1192755	hsa-miR-616	CLIP-seq
MIRT2284674	hsa-miR-769-3p	CLIP-seq
MIRT2284675	hsa-miR-892a	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT2582468	hsa-miR-124	CLIP-seq
MIRT2582469	hsa-miR-1245b-3p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT2582470	hsa-miR-1264	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT2582471	hsa-miR-1291	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT2582472	hsa-miR-1298	CLIP-seq
MIRT1192620	hsa-miR-1299	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT2582473	hsa-miR-142-3p	CLIP-seq
MIRT2582474	hsa-miR-154	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT2582475	hsa-miR-3065-5p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2582476	hsa-miR-3119	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2582477	hsa-miR-3127-5p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT1192607	hsa-miR-3143	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT1192643	hsa-miR-3163	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2582478	hsa-miR-3171	CLIP-seq
MIRT2582479	hsa-miR-3179	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT2582480	hsa-miR-328	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT2582481	hsa-miR-339-3p	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT2055950	hsa-miR-3654	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT2582482	hsa-miR-3680	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT2582483	hsa-miR-3688-3p	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT2582484	hsa-miR-3691-3p	CLIP-seq
MIRT2582485	hsa-miR-3714	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT2582486	hsa-miR-3910	CLIP-seq
MIRT2582487	hsa-miR-3918	CLIP-seq
MIRT2582488	hsa-miR-3978	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT2582489	hsa-miR-4270	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2582490	hsa-miR-4423-5p	CLIP-seq
MIRT2582491	hsa-miR-4426	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2582492	hsa-miR-4441	CLIP-seq
MIRT2582493	hsa-miR-4452	CLIP-seq
MIRT2582494	hsa-miR-4471	CLIP-seq
MIRT2582495	hsa-miR-4477b	CLIP-seq
MIRT2582496	hsa-miR-4480	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT2582497	hsa-miR-4493	CLIP-seq
MIRT2582498	hsa-miR-4512	CLIP-seq
MIRT2582499	hsa-miR-4647	CLIP-seq
MIRT2582500	hsa-miR-4662b	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT1192731	hsa-miR-4700-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT2582501	hsa-miR-4757-5p	CLIP-seq
MIRT2582502	hsa-miR-4778-3p	CLIP-seq
MIRT2582503	hsa-miR-4782-5p	CLIP-seq
MIRT2582504	hsa-miR-4786-5p	CLIP-seq
MIRT1192673	hsa-miR-4789-5p	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT2582505	hsa-miR-495	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT2582506	hsa-miR-506	CLIP-seq
MIRT2582507	hsa-miR-514	CLIP-seq
MIRT2582508	hsa-miR-514b-3p	CLIP-seq
MIRT2582509	hsa-miR-516b	CLIP-seq
MIRT1192615	hsa-miR-543	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT2582510	hsa-miR-548v	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT2582511	hsa-miR-639	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT2582512	hsa-miR-769-5p	CLIP-seq
MIRT1192688	hsa-miR-875-3p	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192690	hsa-miR-1185	CLIP-seq
MIRT1192691	hsa-miR-1208	CLIP-seq
MIRT2582469	hsa-miR-1245b-3p	CLIP-seq
MIRT1192693	hsa-miR-1253	CLIP-seq
MIRT2582470	hsa-miR-1264	CLIP-seq
MIRT1192694	hsa-miR-1267	CLIP-seq
MIRT1192619	hsa-miR-1283	CLIP-seq
MIRT2582471	hsa-miR-1291	CLIP-seq
MIRT1192696	hsa-miR-1293	CLIP-seq
MIRT1192697	hsa-miR-129-5p	CLIP-seq
MIRT2582472	hsa-miR-1298	CLIP-seq
MIRT1192698	hsa-miR-139-5p	CLIP-seq
MIRT2582473	hsa-miR-142-3p	CLIP-seq
MIRT2582474	hsa-miR-154	CLIP-seq
MIRT1192624	hsa-miR-181a	CLIP-seq
MIRT1192625	hsa-miR-181b	CLIP-seq
MIRT1192626	hsa-miR-181c	CLIP-seq
MIRT1192627	hsa-miR-181d	CLIP-seq
MIRT1192699	hsa-miR-1827	CLIP-seq
MIRT2431623	hsa-miR-199a-3p	CLIP-seq
MIRT2431624	hsa-miR-199b-3p	CLIP-seq
MIRT2686538	hsa-miR-205	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192702	hsa-miR-216b	CLIP-seq
MIRT1192703	hsa-miR-2467-3p	CLIP-seq
MIRT2431625	hsa-miR-3074-5p	CLIP-seq
MIRT2582476	hsa-miR-3119	CLIP-seq
MIRT2431626	hsa-miR-3124-3p	CLIP-seq
MIRT2582477	hsa-miR-3127-5p	CLIP-seq
MIRT2431627	hsa-miR-3129-5p	CLIP-seq
MIRT1192706	hsa-miR-3154	CLIP-seq
MIRT2431628	hsa-miR-3168	CLIP-seq
MIRT2582478	hsa-miR-3171	CLIP-seq
MIRT2582479	hsa-miR-3179	CLIP-seq
MIRT1192708	hsa-miR-323-5p	CLIP-seq
MIRT2582480	hsa-miR-328	CLIP-seq
MIRT2686539	hsa-miR-338-3p	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192608	hsa-miR-3607-3p	CLIP-seq
MIRT1192712	hsa-miR-3612	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT2686540	hsa-miR-3622b-5p	CLIP-seq
MIRT2582465	hsa-miR-3647-3p	CLIP-seq
MIRT2686541	hsa-miR-3670	CLIP-seq
MIRT1192713	hsa-miR-3673	CLIP-seq
MIRT1192714	hsa-miR-3679-5p	CLIP-seq
MIRT2582482	hsa-miR-3680	CLIP-seq
MIRT1192715	hsa-miR-3686	CLIP-seq
MIRT2582483	hsa-miR-3688-3p	CLIP-seq
MIRT1192716	hsa-miR-3689a-3p	CLIP-seq
MIRT1192717	hsa-miR-3689c	CLIP-seq
MIRT2582484	hsa-miR-3691-3p	CLIP-seq
MIRT2582487	hsa-miR-3918	CLIP-seq
MIRT1192654	hsa-miR-410	CLIP-seq
MIRT1192655	hsa-miR-4262	CLIP-seq
MIRT2582489	hsa-miR-4270	CLIP-seq
MIRT2431629	hsa-miR-4277	CLIP-seq
MIRT1192657	hsa-miR-4310	CLIP-seq
MIRT1192660	hsa-miR-4420	CLIP-seq
MIRT2582490	hsa-miR-4423-5p	CLIP-seq
MIRT2582491	hsa-miR-4426	CLIP-seq
MIRT2284668	hsa-miR-4427	CLIP-seq
MIRT2582492	hsa-miR-4441	CLIP-seq
MIRT2582493	hsa-miR-4452	CLIP-seq
MIRT2582494	hsa-miR-4471	CLIP-seq
MIRT2686542	hsa-miR-4474-5p	CLIP-seq
MIRT2582496	hsa-miR-4480	CLIP-seq
MIRT1192723	hsa-miR-4483	CLIP-seq
MIRT2686543	hsa-miR-450b-5p	CLIP-seq
MIRT2582498	hsa-miR-4512	CLIP-seq
MIRT2686544	hsa-miR-4530	CLIP-seq
MIRT2582499	hsa-miR-4647	CLIP-seq
MIRT2582500	hsa-miR-4662b	CLIP-seq
MIRT2431630	hsa-miR-4663	CLIP-seq
MIRT2284671	hsa-miR-4680-3p	CLIP-seq
MIRT2055966	hsa-miR-4703-3p	CLIP-seq
MIRT2055980	hsa-miR-4719	CLIP-seq
MIRT1192734	hsa-miR-4728-5p	CLIP-seq
MIRT2582501	hsa-miR-4757-5p	CLIP-seq
MIRT2582504	hsa-miR-4786-5p	CLIP-seq
MIRT2431631	hsa-miR-4799-5p	CLIP-seq
MIRT2431632	hsa-miR-486-5p	CLIP-seq
MIRT2582466	hsa-miR-500a	CLIP-seq
MIRT1192675	hsa-miR-507	CLIP-seq
MIRT2686545	hsa-miR-542-3p	CLIP-seq
MIRT2055981	hsa-miR-545	CLIP-seq
MIRT1192680	hsa-miR-548ah	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192682	hsa-miR-548t	CLIP-seq
MIRT2582510	hsa-miR-548v	CLIP-seq
MIRT1192683	hsa-miR-557	CLIP-seq
MIRT2582467	hsa-miR-568	CLIP-seq
MIRT1192753	hsa-miR-570	CLIP-seq
MIRT2055984	hsa-miR-582-5p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq
MIRT2582511	hsa-miR-639	CLIP-seq
MIRT1192758	hsa-miR-650	CLIP-seq
MIRT2582512	hsa-miR-769-5p	CLIP-seq
MIRT2686546	hsa-miR-873	CLIP-seq
MIRT2431633	hsa-miR-936	CLIP-seq
MIRT2686547	hsa-miR-944	CLIP-seq
MIRT1192689	hsa-miR-1	CLIP-seq
MIRT1192700	hsa-miR-206	CLIP-seq
MIRT1192701	hsa-miR-216a	CLIP-seq
MIRT1192705	hsa-miR-300	CLIP-seq
MIRT1192709	hsa-miR-338-5p	CLIP-seq
MIRT1192648	hsa-miR-3613-3p	CLIP-seq
MIRT1192718	hsa-miR-381	CLIP-seq
MIRT1192729	hsa-miR-4666-3p	CLIP-seq
MIRT1192681	hsa-miR-548c-3p	CLIP-seq
MIRT1192754	hsa-miR-613	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
CLOCK	Repression	21164265
HIF1A	Unknown	15699159
MYB	Unknown	22516378
NR3C1	Unknown	22516378
TFAP2A	Activation	7794935
YY1	Unknown	10030686

102

Show/Hide all (102)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	1894621
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12902338
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	1894621
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16728402
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	17081986
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	1894621
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16728402, 23823477, 28139699
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15769988
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7769088, 10903900
GO:0003723	Function	RNA binding	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	17635946
GO:0004883	Function	Nuclear glucocorticoid receptor activity	IEA
GO:0004883	Function	Nuclear glucocorticoid receptor activity	TAS	8621628
GO:0005496	Function	Steroid binding	IDA	15769988
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	9079630, 10364267, 11266503, 12552091, 12773562, 12902338, 15591535, 15769988, 15941832, 16606617, 16619302, 16888650, 17003263, 17635946, 17978169, 19141540, 19841061, 20195357, 20211142, 21980503, 22170608, 24291004, 24658140, 24949977, 26031419, 27353360, 31467278, 31980649, 3281
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	1894621
GO:0005634	Component	Nucleus	IDA	28139699
GO:0005634	Component	Nucleus	IDA	9353307, 15769988, 17635946, 22022502, 23878391
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9873044
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	15769988, 17635946, 22022502
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9873044
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	10887960
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	17081986, 19141540
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007165	Process	Signal transduction	TAS	7769088
GO:0008211	Process	Glucocorticoid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010467	Process	Gene expression	IEA
GO:0014004	Process	Microglia differentiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA	9353307
GO:0017025	Function	TBP-class protein binding	IPI	19841061
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	20371704
GO:0030325	Process	Adrenal gland development	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IBA
GO:0031946	Process	Regulation of glucocorticoid biosynthetic process	IEA
GO:0031958	Process	Nuclear receptor-mediated corticosteroid signaling pathway	IEA
GO:0032991	Component	Protein-containing complex	IDA	26593036
GO:0034056	Function	Estrogen response element binding	IBA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042921	Process	Nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:0042921	Process	Nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	1894621
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15769988, 16728402, 23823477
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9353307
GO:0046872	Function	Metal ion binding	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0051301	Process	Cell division	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051414	Process	Response to cortisol	IEA
GO:0051879	Function	Hsp90 protein binding	IPI	26593036
GO:0060603	Process	Mammary gland duct morphogenesis	IEA
GO:0061744	Process	Motor behavior	IEA
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	15769988, 17635946
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IDA	9353307, 28139699
GO:0071549	Process	Cellular response to dexamethasone stimulus	IMP	12902338
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	12902338
GO:0150076	Process	Neuroinflammatory response	IEA
GO:1901654	Process	Response to ketone	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	27334923
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1990239	Function	Steroid hormone binding	IDA	17635946
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
138040	7978	ENSG00000113580

P04150

Protein name

Glucocorticoid receptor (GR) (Nuclear receptor subfamily 3 group C member 1)

Protein function

Receptor for glucocorticoids (GC) (PubMed:27120390, PubMed:37478846). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other

PDB

1M2Z , 1NHZ , 1P93 , 3BQD , 3CLD , 3E7C , 3H52 , 3K22 , 3K23 , 4CSJ , 4HN5 , 4HN6 , 4LSJ , 4MDD , 4P6W , 4P6X , 4UDC , 4UDD , 5CBX , 5CBY , 5CBZ , 5CC1 , 5E69 , 5E6A , 5E6B , 5E6C , 5E6D , 5EMC , 5EMP , 5EMQ , 5G3J , 5G5W , 5NFP , 5NFT , 5UC1 , 5UC3 , 5VA0 , 5VA7 , 6BQU , 6CFN , 6DXK , 6EL6 , 6EL7 , 6EL9 , 6X6D , 6X6E , 6YMO , 6YO8 , 6YOS , 7KRJ , 7KW7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02155	GCR	26 → 401	Glucocorticoid receptor	Family
PF00105	zf-C4	419 → 488	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	549 → 741	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed including bone, stomach, lung, liver, colon, breast, ovary, pancreas and kidney (PubMed:25847991). In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and at

Sequence

MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Sequence length

777

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		HSP90 chaperone cycle for steroid hormone receptors (SHR) Nuclear Receptor transcription pathway SUMOylation of intracellular receptors PTK6 Expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Glucocorticoid resistance	Likely pathogenic; Pathogenic	rs770466966, rs104893908, rs587776832, rs104893909, rs104893910, rs104893912, rs121909727	RCV003135489 RCV000017529 RCV000017530 RCV000017533 RCV000017534 RCV000017538 RCV000017541 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
GLUCOCORTICOID RESISTANCE, ATYPICAL	Pathogenic	rs104893911	RCV000017535	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GLUCOCORTICOID RESISTANCE, CELLULAR	Pathogenic	rs121909726	RCV000017531	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (52)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUSHING DISEASE	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY OF GALACTOKINASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLUCOCORTICOID RECEPTOR DEFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLUCOCORTICOID RESISTANCE, GENERALIZED	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLUCOCORTICOID RESISTANCE, MILD	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, OBSTRUCTIVE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NR3C1 POLYMORPHISM	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NR3C1-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY-DEPENDENT CUSHINGS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POTASSIUM DEFICIENCY DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (572)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
46, XX Disorders of Sex Development	46, XX Disorders of Sex Development	CTD_human_DG	11932321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	20015838, 8396510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	30915117		★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	12390341, 19207316, 22570980, 8550738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30408722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10766198, 11069204, 12886242, 15462611, 15704223, 16266991, 17077285, 18385010, 18789525, 20170710, 20354172, 21497906, 22074950, 22739263, 24895125 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	18096310, 27060168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	16118334, 22587831, 23134110, 23239757, 24466047, 28954735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18269582, 29126175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30375484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17118842, 17141072, 17167179, 23196783, 27220856, 9075064, 9861319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	3342039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	19820023, 20438742, 21362280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	16118334, 29796117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	21742609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Congenital adrenal hyperplasia	Pubtator	21042587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35992138, 37793855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15462611, 16266991, 18385010, 20170710, 20354172, 22074950, 22739263, 26062300, 27717743, 28578002, 29312638, 30537513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19820023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	35992138	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26635083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34697589, 39796199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	23239757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32732921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	33284958, 8647313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	30079801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30079801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	28069032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	28069032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	28618657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	39778819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	16134770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	26938822, 28043861		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	11566214, 17982880, 18536531, 23566423, 25001955, 26152664, 27040859, 27378548, 28219813, 28408299, 28863347, 29100173, 30240345, 30824750, 30850750, 30852427 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	29100173	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	32957930, 33215541, 33373777, 33762648, 34572069, 34715840, 39778819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	11566214, 17982880, 19560279, 23406438, 23566423, 24411633, 25001955, 26152664, 27040859, 27378548, 28219813, 28408299, 28863347, 29100173, 29955235 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23406438, 24756342, 27378548, 37023023, 37254074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28428441, 30305646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19820023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	21042587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Mineralocortocoid excess	Pubtator	21042587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11179765, 26186654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29267302, 29997111, 30411492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19877072, 20727199, 22889053, 25724472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10200007, 10435109, 10903212, 11677765, 12400872, 15295049, 15635817, 15826950, 16387802, 16567656, 17672811, 18417060, 18952539, 19619331, 20538962 View all (40 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12237016, 16387802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15295049, 15635817, 16567656, 18396779, 21113676, 21917909, 22015776, 25411910, 25625944, 25748343, 25897650, 26635083, 30544846, 30736733, 30738043 View all (8 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	25488691	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11179765, 26186654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26186654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26820676, 28458039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27391809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26820676, 27391809, 27741480, 28458039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25912394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	28374975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15212141, 17251024, 22823394, 26480216, 28049829, 29526633, 29643853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29643853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	26556219		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21121775, 30694908		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17699872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	15576061, 15872096, 19133972, 19906241, 21531081, 21764460, 21881570, 22085474, 22427805, 22812453, 23068076, 23938235, 24345775, 26349556, 28291257		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	15576061		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21881570, 22427805, 22812453, 24143878, 24345775, 28291257, 37761918, 38482990	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23068076, 23938235, 24012103, 24345775, 25522387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25522387	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23033490, 25015855, 26322830, 27036026, 30518063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	30273601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22085474, 22139575, 22832351, 23417893, 25048180, 25612291, 26080088, 30711865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	22139575, 22832351, 25612291, 26080088, 33705478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35563330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	39314520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37418975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37878192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10748103, 11400122, 11891846, 12559052, 17937626, 19440893, 21818591, 24622770, 24735610, 26424557, 27141101, 28102225, 28434943, 29078321, 29636357 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10751396, 12559052, 15590693, 18668364, 20018896, 23342266, 26424557, 27062924, 27141101, 28262792, 28832545, 29792595, 30103404, 30726932, 30987626 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24622770	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26825173, 29991529	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	29396493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	21190962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	29352737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	20156759, 9731032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22085474, 25409741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	25409741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	21093928, 22088926, 23417893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	28887823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8122366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17167179, 31772120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16639692, 18269582, 25015855, 9582497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30769091, 38604154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23033490, 26322830, 27036026, 30518063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15531725, 27179949, 27484907, 31015126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37807060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17392827, 29636077, 39756106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30726934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24629067, 28456378, 30683758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25338953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12376590, 16676134, 16849409, 18195193, 18812484, 21146942, 23212335, 23892712, 27600822, 28096152, 31601045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16849409, 27600822, 36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	30084690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Intimal Medial Thickness 1	Carotid intima-media thickness	Pubtator	37023023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	29651892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	12903052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29651892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	23025717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30306311		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30306311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11417479, 14607754, 15462611, 15704223, 15759037, 16115950, 16154856, 16266991, 16574952, 17483364, 18385010, 19758697, 20170710, 20354172, 20647567 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	15635817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	22922423, 29145837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	15635817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	21531004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30445609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17699872, 7584520, 9920778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20156759, 24070494, 24368768, 30738183, 31814707, 9926163		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Pain	Chronic pain	Pubtator	30079801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	25943109, 27639937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	18396779, 20488636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	17982880, 30838650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21544576, 33284958, 38482990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37107586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30936873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	15635817, 15793862, 34733451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19427965, 25666906, 28978062, 3342039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31375708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17167179, 24622770, 3342039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17167179, 24622770, 28902367, 31375708, 32533587, 32953885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	28069032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25394950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	25894927, 27741480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	16728546, 23028665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	Pubtator	23028665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation syndrome	Congenital central hypoventilation syndrome	Pubtator	36538565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	11987085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	11987085, 17065567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital secretory diarrhea, sodium type (disorder)	Congenital secretory diarrhea	BEFREE	28577990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20371666, 23714253, 30946837, 31311395, 31673803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21531004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11344238, 12623935, 18195193, 19783104, 23009206, 23151527		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11344238, 12623935, 18195193, 19783104, 21971518, 23009206, 23151527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12623935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23009206	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29473427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19783104, 25683698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11344238, 12623935, 18195193, 19783104, 20371666, 23151527, 25683698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Critical Illness	Critical illness	Pubtator	37409973, 39314520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15996200, 19673019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19673019, 21633323, 21788965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	10634357, 16855182, 18827003, 19207316, 21042587, 22048965, 22570980, 24126765, 24915124, 26873309, 27120390, 28368581, 28928236, 29302209, 30019523 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	10802524, 16855182, 24483153, 26873309, 34489873, 36233250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36555435	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18047640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18047640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18047640, 31664087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	1350680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30445185, 8496302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	21438141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17184882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	29882567, 31837802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	10442170, 11566214, 15885359, 17524489, 18286599, 18423443, 19051288, 19089807, 19708722, 19783104, 20047716, 20399565, 21477816, 21764460, 22760121 View all (48 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19783104, 21544576, 23406438, 24135662, 26186654, 28179212, 29936334, 31438539, 32218512, 32699209, 33373777, 33762648, 34903727, 36091061, 36233250, 39778819 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	24655651, 24690014, 25358426, 25522420, 26050039		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	29100173, 29556870	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	32652588	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	19540336, 20726698, 22832351, 23406438, 25765757, 26782558, 34903727, 36233250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31802387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	20536659, 26635083, 30522881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30737086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	29058930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22048965, 26896766, 27381417, 30091218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23209187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11344238, 22048965, 26896766, 27381417, 30091218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12805402, 22587831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23212335	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27600822, 36233250, 38217051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28481181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11672459, 12376590, 12805402, 12864802, 15931615, 22048965, 30091218, 31524257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35749380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36068241	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31328390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	1783404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	7704085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	20824100, 30963711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30963711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	23567489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	22587831, 25944971, 28938459, 29599416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	25944971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyspepsia	Dysphasia	Pubtator	28179212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	20440229, 23417893, 25220664, 27400218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20536659, 26635083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28927900, 29539426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29539426, 34813298, 8878453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	15011750, 22521153, 40124382	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	22521153, 29137551		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	BEFREE	23762334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	11077088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28527108, 31618599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	30264400, 32748370, 34697589, 35563330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	32652588	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28527108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21158453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21158453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32106831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10601116, 23892638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	12805402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31577941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	16740143, 19540336, 20941551, 24054763, 26272340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28717104, 29514097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29042644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	CTD_human_DG	11932321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	BEFREE	16890204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Female Pseudohermaphroditism	Female Pseudohermaphroditism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22311344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10597035, 9488041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27355192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	35563330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30103756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized glucocorticoid resistance syndrome	Glucocorticoid Resistance Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	11476953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	10438153, 24506296, 31050723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	18326728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20376328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20376328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Suspect	Glaucoma	CTD_human_DG	17563720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34769089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19116788, 23906498, 25301232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27560795, 31734653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27730700, 34831409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	34831409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	27998979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	10068517, 10442170, 10843199, 11069204, 11358672, 11358809, 11417479, 11589680, 12390341, 12430185, 12967327, 15265781, 15292341, 15635817, 15759037 View all (65 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	UNIPROT_DG	11589680, 11701741, 12050230, 15769988, 1704018, 17635946, 20335448, 21362280, 23426617, 24483153, 26031419, 26541474, 27120390, 7683692		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	16380507, 16855182, 20335448, 20861124, 21042587, 22260204, 22889053, 23512537, 24466047, 24483153, 24895125, 25938942, 26715915, 26745667, 27077774 View all (5 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	ORPHANET_DG	19933394, 23076843		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	32699209	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glucose Metabolism Disorders	Glucose Metabolism Disorders	CTD_human_DG	29802709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	25843653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	25843653, 26508783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	19691529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	BEFREE	31522177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	12207914, 15996200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hay-Wells syndrome	Hay-Wells syndrome	BEFREE	30927408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	28366034, 36782309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32218512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20371666, 23714253, 30946837, 31311395, 31673803		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HELLP Syndrome	HELLP Syndrome	BEFREE	19336230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11358809, 20354172, 8733004, 8809670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20354172, 23255118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	18201403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28374975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	39297647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18239069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	29587872, 30999951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	21531004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	10068517, 11287026, 25715669, 31344428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	11287026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25161081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	16849409, 18812484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	2612051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28928236, 30659202, 31070948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	1362060, 15292341, 18194492, 28397446, 30400058, 31199473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	34715840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	23877856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16849409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16849409, 18812484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12805402, 20335448, 21042587, 21544576, 23028665, 27649075, 30545316	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	11344238, 12376590, 12805402, 18697839, 21042587, 23076843, 25568318, 25715669, 28928236, 30038578, 30545316, 8096533, 8564448		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	18434569, 20659135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	18827003		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30866692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	18182467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	20335448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29510671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	29033349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26825173, 36589842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27560795	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30126083, 31315247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	31657082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	17251024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	20419394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15282390, 35865549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31545224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31545224	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27730700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	19691529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23435844, 23527567, 30499912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	17982880, 24915124, 28086911, 28855330, 30838650, 31255679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	17251024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	20943324, 22728713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	12605259, 29953984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12967327, 20697295, 20712049, 22752665, 26480216, 30936873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	20712049, 39874239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31802387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	12351458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	38482990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	20712049, 25630611, 27038676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27038676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29651892, 30126083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	19933394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10364352, 26032496, 8669484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37477126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30698046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30445609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29991691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	29796117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22311344, 35426036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10898924, 16890204, 21121775, 9073327		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15895983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16574952, 20170710, 20831260, 21224468, 25938942, 36490346, 7859735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28855357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28374517, 29885846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	15265780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18269582, 29031898, 3014347, 7693573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	15635817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21380616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	7693573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	18047640, 24488492, 28937774, 8810618		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	18047640, 24488492	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	15282390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31545224, 39756106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	17407502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Obstructive	Lung Diseases	CTD_human_DG	9926163		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16806572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27484907, 28819152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15212141, 19594946, 24151836, 39874239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11708406, 15212141, 18165172, 20032106, 24151836, 25665148, 25899090, 26255187, 28984075, 29643853, 30850964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15212141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	11694247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	11069204, 24895125, 29802709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16461807, 29107989, 29738549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28978062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16461807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	30782088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16192984, 16580345, 17034955, 18246526, 19199039, 19545546, 19782477, 19906241, 19906242, 20726698, 21195417, 21764460, 22237309, 22832351, 22832853 View all (23 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24424390, 24465557, 25150007, 25355489, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	32748370, 35563330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10748103, 11400122, 12559052, 17937626, 19440893, 21818591, 24622770, 24735610, 25847991, 26424557, 27141101, 28102225, 28262792, 28434943, 29078321 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28927900, 29539426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21158453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15531725, 27179949, 27484907, 31015126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24629067, 28456378, 30683758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21078539, 21563193, 24615402, 26015065, 26483423, 27340920, 27987128, 28069826, 28191869, 28428441, 28611094, 28891793, 29158269, 29194690, 29755660 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19569046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23033490, 26322830, 27036026, 30518063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15635817, 16639692, 19223869, 22074950, 24488492, 24824564, 25847991, 27036026, 27141101, 27401254, 28102225, 28196872, 28293120, 29107989, 29158269 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30306311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19427965, 25666906, 28978062, 3342039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	21544576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	22223754, 28076749, 28916632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15590693, 17952860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24622770, 29991529, 31675993, 7768643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial Dysostosis	BEFREE	1676560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibulofacial Dysostosis	Mandibulofacial dysostosis	Pubtator	1676560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	19133972, 21531081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	23068076		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21455635, 28293120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21455635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17236775, 8587697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10442170, 11566214, 15885359, 17524489, 18286599, 18423443, 19051288, 19089807, 19708722, 19783104, 20047716, 20399565, 21477816, 21764460, 22760121 View all (45 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24655651, 24690014, 25358426, 25522420, 26050039		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	21881570, 22427805, 22812453, 23407841, 24832930, 26050039, 26080088, 26752119, 26782558, 27485401, 27527158, 27691985, 27741480, 29449045, 29650294, 30176278 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	31618599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic alkalosis	Metabolic alkalosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	18697839, 20170729, 30321321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	18983327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35120172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	15919839, 16855182, 22587831, 22801563, 23028665, 23212335, 27600822, 33311027, 37761945	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11916927, 12376590, 15919839, 16855182, 21964795, 22587831, 22801563, 24302289, 25104270, 26596278, 27507764, 27600822, 27634941, 28915330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30425524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20716560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30086534, 30580022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	12399952, 16458268, 19133972, 19906241, 22085474, 22641177, 24135662, 24253961, 26752119, 28174120, 28729116		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	16458268		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	21907973, 22641177, 23270599, 24135662, 24253961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	24135662, 29556870, 33373777	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	CTD_human_DG	29921868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28567088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	17102092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	17102092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	1728309, 18499442, 19133980, 19330649, 22855579, 29312638, 31645658, 7796394, 7873993, 8358712, 9375757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	1728309, 18499442, 19133980, 22855579, 23255118, 25474406, 26715915, 31645658, 32228485, 32921213, 33284947, 34481515, 34600510, 9375757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16083972, 17395275, 18573821, 19318444, 25175068, 27000245, 27725129, 28049829		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	39201568	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	16980656, 17937535, 33287327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	16980656, 28432191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	LHGDN	16980656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	21355091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18195193, 24466047, 25015855, 28768721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24466047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	17251024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11258648, 18671773, 23124618, 23562201, 25943109, 27639937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	18396779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	18396779, 32870597, 35690807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10364352, 10604389, 12230951, 12390341, 16382005, 16639692, 16775428, 18559523, 19820023, 20015838, 21455635, 21531004, 21742609, 21984896, 22328717 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	14733805, 16890204, 18343955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	16890204, 18343955, 24429396, 28751734, 29207898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	24429396, 28751734, 34603785, 40055727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	20419394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	29796117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11080152, 28794031, 30602606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11080152, 35850708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25656655, 31726042, 31766220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	29965797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29743929, 30321321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	26556219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24736075, 28755014, 29674424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24166410, 24933348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10650936, 10832763, 11344238, 12805402, 12864802, 12915696, 12917495, 1362060, 16210701, 16222046, 16725041, 16855182, 17148738, 20440229, 21050724 View all (15 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	12805402, 15919839, 16210701, 16855182, 19564704, 20054173, 22587831, 22801563, 23028665, 23778418, 23784897, 23975165, 26821164, 28125591, 32849611, 36233250 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	12917495	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23009206	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	10832763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	17563720, 24417561, 29339763, 31050723		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	LHGDN	17563720		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	CTD_human_DG	17563720		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular hypertension	Pubtator	17563720, 25813999	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31340854, 31675993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	23055001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27716396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19207316, 24126765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	17002564, 17937535, 33494362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30273601, 31592234, 31805987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10748103, 16239257, 17682054, 1846564, 21527497, 30020469, 9174122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21853138, 22174376, 23303127, 33494362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	15870720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	33786734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24629067, 28456378, 30683758, 8878453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12230951, 24629067, 28456378, 8878453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26935408	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	21531004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	37222222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26516212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29935433, 30006609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	28928407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	28928407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	30176278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17102092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	16639692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	34489873, 9506748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29471911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11119758, 21803757, 22068557, 24626943, 25402380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	11119758, 24626943, 38217051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	35861015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21355091, 22879541, 28232234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	21355091, 22879541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	17251024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	15511603, 18349090, 19393990, 20706708, 21169818, 21508514, 21536970, 21907973, 22137507, 22832351, 22981834, 23148886, 23856297, 24466032, 24661442 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	20170710, 20831260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	10068517, 11287026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	29510671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20170710, 20831260, 22516378, 24895125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20831260, 21084380, 22516378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10766198, 11069204, 15704223, 17077285, 20354172, 21497906, 24895125, 26062300, 27050122, 29802709, 30305606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20170710, 21979877, 22739263, 23228967, 8895760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17184882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15635817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	19218654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21355091, 22879541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	BEFREE	19383776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15635817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	31388769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18559523, 21078539, 21563193, 24615402, 26015065, 26483423, 27987128, 28069826, 28191869, 28428441, 28611094, 28891793, 29158269, 29194690, 29755660 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17540466, 18097517, 26483423, 27340920, 28069826, 29436611, 30305646, 31727962, 31861264, 33303959, 33619826, 33795839, 35184651, 36452480, 37169162 View all (4 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25138562		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	34831409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohermaphroditism, Female, With Hypokalemia, Due To Glucocorticoid Resistance	Pseudohermaphroditism, Female, With Hypokalemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohermaphroditism, Female, With Hypokalemia, Due To Glucocorticoid Resistance	Pseudohermaphroditism, Female, With Hypokalemia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	24166410, 24933348, 26782558		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	24345775, 33284958	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20156759, 23704983, 24070494, 24368768, 25573300, 27769261, 29796117, 31022961, 35120172, 38641747, 9926163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32021151, 35553638	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	29587872, 30999951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	23073785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	16192984		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15489000, 21531004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	20007344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	31166704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	28794031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	27079262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	15265772, 22088618, 27079262, 29522858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22001906, 27079262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	28794031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	39393618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	7704085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11708406, 12114259, 16134770, 17532759, 18830906, 19347182, 19877072, 20727199, 21128210, 21233489, 22889053, 25724472, 28328159, 29112329, 31139184, 31820730 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	11708406, 16446173, 18830906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	31618599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	2036813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	11836450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	7887453, 8669484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10898924, 12399952, 15576061, 21050724, 21881570, 22427805, 22812453, 23938174, 24345775, 24702539, 25751398, 30696808		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	14708030, 21647420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15576061		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21881570, 22427805, 22812453, 24345775, 33284958	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	14708030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	20335448, 32748370, 37593891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15382119, 19373457, 23248291, 29787416, 29788135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe major depression with psychotic features	Mental Depression With Psychotic Features	BEFREE	28708736, 29523415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	27050997	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	15611350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	36748964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29894769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	15531725, 17496926, 20015838, 21984896, 24036132, 28434943, 29559689, 7491111, 9783913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	17496926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	21984896, 34741430, 8163665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	29559689	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	19933394, 23567489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	11400122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17392827, 18269582, 30306311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	29935090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	17392827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28717104, 29514097, 31199473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	16890204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	18343955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19569046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	28993273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18158559, 33407483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders, Traumatic	Stress Disorder	BEFREE	30824750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	21355091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	18156379, 24128430, 28077500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	LHGDN	18156379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	18468809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24166279, 26374485, 26825173, 28293120, 28832545, 29620157, 29991529, 30862604, 31274313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26374485, 26825173, 29620157, 29991529, 32816914, 39519365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	23567489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10784585, 11515845, 15635817, 21788965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	14708030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	16580345, 17034955, 18246526, 18286599, 19545546, 19782477, 19906241, 19906242, 21764460, 22237309, 23123359, 24424390, 24465557, 26057048, 26349556 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	24424390, 24465557, 25150007, 25355489, 25522420		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25015855	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27036026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	27635763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23033490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26210472, 33494362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22311344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	12605259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	28535268, 31323199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30117098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	30158362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	17102092		★★★★★ ★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	20943324, 22728713		★★★★★ ★☆☆☆☆ Found in Text Mining only

NR3C1 (nuclear receptor subfamily 3 group C member 1)