KLF15 (KLF transcription factor 15)

Gene

• Entrez ID: 28999
• Gene name: KLF transcription factor 15
• Gene symbol: KLF15
• Synonyms (NCBI Gene): KKLF
• Chromosome: 3
• Chromosome location: 3q21.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016690	hsa-miR-133b	Other	19720047
MIRT016690	hsa-miR-133b	Other	19720047
MIRT035579	hsa-miR-133a-3p	Other	19720047
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979415
MIRT731939	hsa-miR-376a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27979415
MIRT1096204	hsa-miR-1228	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT1096210	hsa-miR-1587	CLIP-seq
MIRT1096211	hsa-miR-1915	CLIP-seq
MIRT1096212	hsa-miR-342-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT1096214	hsa-miR-4417	CLIP-seq
MIRT1096215	hsa-miR-4490	CLIP-seq
MIRT1096216	hsa-miR-4492	CLIP-seq
MIRT1096217	hsa-miR-4498	CLIP-seq
MIRT1096218	hsa-miR-4656	CLIP-seq
MIRT1096219	hsa-miR-4675	CLIP-seq
MIRT1096220	hsa-miR-4726-3p	CLIP-seq
MIRT1096221	hsa-miR-4741	CLIP-seq
MIRT1096222	hsa-miR-541	CLIP-seq
MIRT1096223	hsa-miR-654-5p	CLIP-seq
MIRT1096224	hsa-miR-762	CLIP-seq
MIRT2025977	hsa-miR-1237	CLIP-seq
MIRT2025978	hsa-miR-1538	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT2025981	hsa-miR-4279	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2025984	hsa-miR-4745-3p	CLIP-seq
MIRT2257016	hsa-miR-103a	CLIP-seq
MIRT2257017	hsa-miR-107	CLIP-seq
MIRT2257018	hsa-miR-1184	CLIP-seq
MIRT2257019	hsa-miR-1226	CLIP-seq
MIRT1096205	hsa-miR-128	CLIP-seq
MIRT1096206	hsa-miR-140-3p	CLIP-seq
MIRT1096207	hsa-miR-148a	CLIP-seq
MIRT1096208	hsa-miR-148b	CLIP-seq
MIRT1096209	hsa-miR-152	CLIP-seq
MIRT2025979	hsa-miR-1913	CLIP-seq
MIRT2257020	hsa-miR-194	CLIP-seq
MIRT2257021	hsa-miR-2467-3p	CLIP-seq
MIRT2025980	hsa-miR-324-3p	CLIP-seq
MIRT1096213	hsa-miR-3944-5p	CLIP-seq
MIRT2025982	hsa-miR-4313	CLIP-seq
MIRT2257022	hsa-miR-4701-5p	CLIP-seq
MIRT2025983	hsa-miR-4722-3p	CLIP-seq
MIRT2257023	hsa-miR-4803	CLIP-seq
MIRT2257024	hsa-miR-588	CLIP-seq
MIRT2257025	hsa-miR-922	CLIP-seq
MIRT2389899	hsa-miR-4305	CLIP-seq
MIRT2389900	hsa-miR-4777-5p	CLIP-seq
MIRT2389901	hsa-miR-518d-5p	CLIP-seq
MIRT2389902	hsa-miR-519b-5p	CLIP-seq
MIRT2389903	hsa-miR-519c-5p	CLIP-seq
MIRT2389904	hsa-miR-520c-5p	CLIP-seq
MIRT2389905	hsa-miR-526a	CLIP-seq
MIRT2389906	hsa-miR-586	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19767294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	19767294
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	23999430, 24722188, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17438289
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19767294
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071635	Process	Negative regulation of transforming growth factor beta production	IEA
GO:0072112	Process	Podocyte differentiation	IEA
GO:0072112	Process	Podocyte differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IMP	20375365

Other IDs

• MIM: 606465
• HGNC: 14536
• e!Ensembl: ENSG00000163884

Protein

• UniProt ID: Q9UIH9
• Protein name: Krueppel-like factor 15 (Kidney-enriched krueppel-like factor)
• Protein function: Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CCN2 expression, involved in the control of car
• PDB: 2ENT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	321 → 345	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	351 → 375	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	381 → 403	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver, skeletal muscle, and kidney. Expressed in cardiomyocytes. Expression is highly reduced in cardiac tissue of patients with non-ischemic cardiomyopathy and aortic aneurysm, and in glomerular disease. Not expres
• Sequence:

  MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQAL
  CSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHF
  CLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKS
  HLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPG
  QAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGP
  AGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGW
  RFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

• Sequence length: 416

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR TELANGIECTASIA TYPE 2	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31776270		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29299121, 29990857		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	29146897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	BEFREE	20375365		★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	26600407		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	17438289		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23999430		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23999430		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25869021		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27629257, 31640084	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36347994	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36347994	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	28400202	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	29956764	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	33757590	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26600407, 28336438, 30831134		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29901095		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29970016, 31523196		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30538440		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31610194		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38273088	Inhibit	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19720047, 20375365, 24407292, 28336438, 29288718, 29702551, 30831134		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30089854, 31582141		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30089854		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30089854		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30036111		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28400202		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29901095, 31105790		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	26600407		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27199507		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	27199507	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24167585		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33275234	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	20375365, 24407292, 28336438, 29288718, 29702551, 30831134		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28400202	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30830866		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28400202, 29472234, 30538440, 31697927		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	31697927		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	28400202, 37302544	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28570579	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29956764, 30143559, 31523196		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29956764	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29901095		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19720047, 28400202, 29702551, 29970016		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	27288011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25869021		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28421457		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25869021, 29299121		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29901095		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29735415		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29288718		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	21937448		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31582141		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29288718		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25869021, 26523541, 27629257, 29299121		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30143559		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24358263, 27199507, 29241541		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27199507, 28570579	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32731816	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39585802	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal fibrosis	Renal fibrosis	BEFREE	28651950, 29179208, 30662001		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29263295		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29735415		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29098164		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	24167585		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28421457		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34727954	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36347994	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	23999430		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	29956764	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	28400202	Associate	★☆☆☆☆ Found in Text Mining only