Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	28989
Gene name	N-terminal Xaa-Pro-Lys N-methyltransferase 1
Gene symbol	NTMT1
Synonyms (NCBI Gene)	AD-003C9orf32HOMT1AMETTL11ANRMTNRMT1NTM1A
Chromosome	9
Chromosome location	9q34.11
Summary	The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 6009

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022881	hsa-miR-124-3p	Microarray	18668037
MIRT047648	hsa-miR-10a-5p	CLASH	23622248
MIRT722252	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT722251	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT722250	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT722249	hsa-miR-4433a-5p	HITS-CLIP	19536157
MIRT619008	hsa-miR-562	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	HITS-CLIP	23824327
MIRT619007	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619006	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619005	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT619004	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT516166	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT619003	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT619002	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT619001	hsa-miR-5096	HITS-CLIP	23824327
MIRT516163	hsa-miR-1303	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516173	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516172	hsa-miR-29a-5p	PAR-CLIP	23446348
MIRT516171	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT516170	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT516169	hsa-miR-1254	PAR-CLIP	23446348
MIRT516168	hsa-miR-3116	PAR-CLIP	23446348
MIRT516167	hsa-miR-661	PAR-CLIP	23446348
MIRT516166	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516164	hsa-miR-3149	PAR-CLIP	23446348
MIRT516163	hsa-miR-1303	PAR-CLIP	23446348
MIRT722252	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT722251	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT722250	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT722249	hsa-miR-4433a-5p	HITS-CLIP	19536157
MIRT619008	hsa-miR-562	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	HITS-CLIP	23824327
MIRT619007	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619006	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619005	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT619004	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT516166	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT619003	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT619002	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT619001	hsa-miR-5096	HITS-CLIP	23824327
MIRT516163	hsa-miR-1303	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516173	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516172	hsa-miR-29a-5p	PAR-CLIP	23446348
MIRT516171	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT516170	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT516169	hsa-miR-1254	PAR-CLIP	23446348
MIRT516168	hsa-miR-3116	PAR-CLIP	23446348
MIRT516167	hsa-miR-661	PAR-CLIP	23446348
MIRT516166	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516164	hsa-miR-3149	PAR-CLIP	23446348
MIRT516163	hsa-miR-1303	PAR-CLIP	23446348

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20668449, 32296183
GO:0005634	Component	Nucleus	IDA	20668449
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0007051	Process	Spindle organization	IBA
GO:0007051	Process	Spindle organization	IMP	20668449
GO:0007059	Process	Chromosome segregation	IMP	20668449
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008276	Function	Protein methyltransferase activity	IDA	20481588, 20668449
GO:0008276	Function	Protein methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018013	Process	N-terminal peptidyl-glycine methylation	IDA	26543159
GO:0018016	Process	N-terminal peptidyl-proline dimethylation	IDA	20481588, 20668449
GO:0032259	Process	Methylation	IEA
GO:0035572	Process	N-terminal peptidyl-serine dimethylation	IDA	20668449
GO:0035573	Process	N-terminal peptidyl-serine trimethylation	IDA	20668449
GO:0042054	Function	Histone methyltransferase activity	IDA	26543159
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IBA
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IDA	26543159
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IEA

MIM	HGNC	e!Ensembl
613560	23373	ENSG00000148335

Q9BV86

Protein name

N-terminal Xaa-Pro-Lys N-methyltransferase 1 (EC 2.1.1.244) (Alpha N-terminal protein methyltransferase 1A) (Methyltransferase-like protein 11A) (N-terminal RCC1 methyltransferase) (X-Pro-Lys N-terminal protein methyltransferase 1A) (NTM1A) [Cleaved into:

Protein function

Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exp

PDB

2EX4 , 5CVD , 5CVE , 5E1B , 5E1D , 5E1M , 5E1O , 5E2A , 5E2B , 6DTN , 6KDQ , 6PVA , 6PVB , 6WH8 , 6WJ7 , 7K3D , 7SS1 , 7U1M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05891	Methyltransf_PK	8 → 223	AdoMet dependent proline di-methyltransferase	Family

Sequence

MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
GTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQ
DFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVD
SSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR

Sequence length

223

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25909287, 28556566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25909287, 28556566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36228414, 39379942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28556566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28556566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28556566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37901469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1)