Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28988
Gene name	Drebrin like
Gene symbol	DBNL
Synonyms (NCBI Gene)	ABP1HIP-55HIP55SH3P7
Chromosome	7
Chromosome location	7p13

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022629	hsa-miR-124-3p	Microarray	18668037
MIRT025775	hsa-miR-7-5p	Microarray	19073608
MIRT028810	hsa-miR-26b-5p	Microarray	19088304
MIRT051893	hsa-let-7b-5p	CLASH	23622248
MIRT046641	hsa-miR-222-3p	CLASH	23622248
MIRT041370	hsa-miR-193b-3p	CLASH	23622248
MIRT052809	hsa-miR-3187-3p	CLASH	23622248
MIRT924051	hsa-miR-103b	CLIP-seq
MIRT924052	hsa-miR-1255a	CLIP-seq
MIRT924053	hsa-miR-1255b	CLIP-seq
MIRT924054	hsa-miR-1302	CLIP-seq
MIRT924055	hsa-miR-1972	CLIP-seq
MIRT924056	hsa-miR-2116	CLIP-seq
MIRT924057	hsa-miR-2467-3p	CLIP-seq
MIRT924058	hsa-miR-3126-5p	CLIP-seq
MIRT924059	hsa-miR-3160-3p	CLIP-seq
MIRT924060	hsa-miR-3170	CLIP-seq
MIRT924061	hsa-miR-324-5p	CLIP-seq
MIRT924062	hsa-miR-342-5p	CLIP-seq
MIRT924063	hsa-miR-346	CLIP-seq
MIRT924064	hsa-miR-3651	CLIP-seq
MIRT924065	hsa-miR-3919	CLIP-seq
MIRT924066	hsa-miR-3922-5p	CLIP-seq
MIRT924067	hsa-miR-3929	CLIP-seq
MIRT924068	hsa-miR-4260	CLIP-seq
MIRT924069	hsa-miR-4271	CLIP-seq
MIRT924070	hsa-miR-4286	CLIP-seq
MIRT924071	hsa-miR-4298	CLIP-seq
MIRT924072	hsa-miR-4419b	CLIP-seq
MIRT924073	hsa-miR-4438	CLIP-seq
MIRT924074	hsa-miR-4462	CLIP-seq
MIRT924075	hsa-miR-4478	CLIP-seq
MIRT924076	hsa-miR-4487	CLIP-seq
MIRT924077	hsa-miR-4514	CLIP-seq
MIRT924078	hsa-miR-4529-5p	CLIP-seq
MIRT924079	hsa-miR-4645-5p	CLIP-seq
MIRT924080	hsa-miR-4651	CLIP-seq
MIRT924081	hsa-miR-4664-5p	CLIP-seq
MIRT924082	hsa-miR-4673	CLIP-seq
MIRT924083	hsa-miR-4677-5p	CLIP-seq
MIRT924084	hsa-miR-4692	CLIP-seq
MIRT924085	hsa-miR-4717-5p	CLIP-seq
MIRT924086	hsa-miR-4725-3p	CLIP-seq
MIRT924087	hsa-miR-4727-5p	CLIP-seq
MIRT924088	hsa-miR-4753-5p	CLIP-seq
MIRT924089	hsa-miR-4756-3p	CLIP-seq
MIRT924090	hsa-miR-4769-3p	CLIP-seq
MIRT924091	hsa-miR-542-3p	CLIP-seq
MIRT924092	hsa-miR-556-5p	CLIP-seq
MIRT924093	hsa-miR-558	CLIP-seq
MIRT924094	hsa-miR-608	CLIP-seq
MIRT924095	hsa-miR-627	CLIP-seq
MIRT924096	hsa-miR-7	CLIP-seq
MIRT924097	hsa-miR-924	CLIP-seq
MIRT924098	hsa-miR-31	CLIP-seq
MIRT924099	hsa-miR-335	CLIP-seq
MIRT924100	hsa-miR-4421	CLIP-seq
MIRT924101	hsa-miR-4688	CLIP-seq
MIRT1973695	hsa-miR-1912	CLIP-seq
MIRT1973696	hsa-miR-1915	CLIP-seq
MIRT1973697	hsa-miR-3130-5p	CLIP-seq
MIRT1973698	hsa-miR-4482	CLIP-seq
MIRT2209211	hsa-miR-3158-3p	CLIP-seq
MIRT2209212	hsa-miR-4435	CLIP-seq
MIRT2209213	hsa-miR-4701-5p	CLIP-seq
MIRT2209214	hsa-miR-548s	CLIP-seq
MIRT2209215	hsa-miR-588	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0002102	Component	Podosome	IEA
GO:0002102	Component	Podosome	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 17306257, 19060904, 21044950, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0005938	Component	Cell cortex	ISS
GO:0006897	Process	Endocytosis	IEA
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0008047	Function	Enzyme activator activity	TAS	10567356
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0016601	Process	Rac protein signal transduction	ISS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	ISS
GO:0061024	Process	Membrane organization	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070161	Component	Anchoring junction	IEA
GO:0071800	Process	Podosome assembly	IEA
GO:0071800	Process	Podosome assembly	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098973	Function	Structural constituent of postsynaptic actin cytoskeleton	IEA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
610106	2696	ENSG00000136279

Q9UJU6

Protein name

Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)

Protein function

Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and sy

PDB

1X67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	12 → 131	Cofilin/tropomyosin-type actin-binding protein	Domain
PF14604	SH3_9	378 → 427	Variant SH3 domain	Domain

Sequence

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQ
QEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHI
DHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM
FPANYVELIE

Sequence length

430

Interactions

View interactions

	Reactome
			Caspase-mediated cleavage of cytoskeletal proteins Neurexins and neuroligins Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOGEN STORAGE DISEASE TYPE X	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31056952, 31133773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	39738466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17651147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22760556		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22760556		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22760556, 35821008	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, MARNER TYPE	Cataract	BEFREE	29233863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18575712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	36220400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23891256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30638160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	17651147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type X	Glycogen Storage Disease	CLINVAR_DG	27612597, 8447317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	15637062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	BEFREE	30504273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28615526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30638160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy, Spinal, Type II	Spinal Muscular Atrophy	BEFREE	22512990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17985251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30638160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30638160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	17651147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	37437773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcortical Band Heterotopia	Subcortical Band Heterotopia	BEFREE	30504273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16489678		★★★★★ ★☆☆☆☆ Found in Text Mining only

DBNL (drebrin like)