RGCC (regulator of cell cycle)

Gene

• Entrez ID: 28984
• Gene name: Regulator of cell cycle
• Gene symbol: RGCC
• Synonyms (NCBI Gene): C13orf15, RGC-32, RGC32, bA157L14.2
• Chromosome: 13
• Chromosome location: 13q14.11
• Summary: This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017536	hsa-miR-335-5p	Microarray	18185580
MIRT029225	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001100	Process	Negative regulation of exit from mitosis	IDA	17146433
GO:0001818	Process	Negative regulation of cytokine production	IMP	19162005
GO:0001819	Process	Positive regulation of cytokine production	IMP	19162005
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	19652095
GO:0002430	Process	Complement receptor mediated signaling pathway	IMP	19162005
GO:0003331	Process	Positive regulation of extracellular matrix constituent secretion	IDA	19158077
GO:0005515	Function	Protein binding	IPI	19162005
GO:0005634	Component	Nucleus	IDA	11687586
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11687586, 17146433
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17146433
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	19158077
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17146433
GO:0010628	Process	Positive regulation of gene expression	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	19158077
GO:0016525	Process	Negative regulation of angiogenesis	IDA	19652095
GO:0019209	Function	Kinase activator activity	ISS
GO:0019887	Function	Protein kinase regulator activity	IMP	19162005
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	11687586, 17146433
GO:0019901	Function	Protein kinase binding	ISS
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0030295	Function	Protein kinase activator activity	IDA	11687586
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19158077
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19162005
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	19652095
GO:0045931	Process	Positive regulation of mitotic cell cycle	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19158077
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	19158077
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070412	Function	R-SMAD binding	IPI	21307346
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095
GO:0072537	Process	Fibroblast activation	IEA
GO:0072537	Process	Fibroblast activation	ISS
GO:0090272	Process	Negative regulation of fibroblast growth factor production	IDA	19652095
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	11687586
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	19162005
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	21307346
GO:1901991	Process	Negative regulation of mitotic cell cycle phase transition	IDA	17146433
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	11687586
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	19158077
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	21307346
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	19652095

Other IDs

• MIM: 610077
• HGNC: 20369
• e!Ensembl: ENSG00000102760

Protein

• UniProt ID: Q9H4X1
• Protein name: Regulator of cell cycle RGCC (Response gene to complement 32 protein) (RGC-32)
• Protein function: Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic f
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15151	RGCC	1 → 137	Response gene to complement 32 protein family	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon,
• Sequence:

  MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
  KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
  KELEAFIADLDKTLASM

• Sequence length: 137

Pathways

KEGG:

Regulation of actin cytoskeleton

Reactome:

TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20236758		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19883641		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27619159, 29449334		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17146433, 26654598		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27619159, 29449334		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28356385, 31250246		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22362714, 23670132, 25230890, 25634217, 29048636, 29843638		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22163048	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20862745	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10619963		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23715780, 24833469		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29035886	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29035886		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29035886		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	17935617	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28689810		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28689810		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20203269		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19883641, 31601783		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19652095		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	38143740	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28470188, 31512793		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19883641	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15932515		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30453650		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	39702546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30453650		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Anhidrotic ectodermal dysplasia with immunodeficiency, osteopetrosis, and lymphedema	Pubtator	31509193	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15932515		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26654598		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11445852, 17146433, 28689810		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	19158077	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22163048	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30355157		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	15932515		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29636874		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	10619963		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22084162		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26308964	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28689810		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28689810		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23715780	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22458379	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31119375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22362714, 23670132, 25230890, 25634217, 29048636, 29843638		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23715780, 24833469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22458379, 28810656, 29886073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28575166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21990323		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12726855, 18373239, 22458379, 23247987, 23670132, 23715780, 24833469, 25418473, 28087598, 28423601, 30306428, 31156630, 31258721		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28689810		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19883641, 31601783		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27938491		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23000427, 26407760, 28356385, 30006805, 31250246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	26407760, 31509193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	23000427		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	23555284		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30355645		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10619963, 10775848, 11520803, 14730602, 15054085, 15809752, 17146433, 19652095, 20069396, 21990323, 22106042, 22242187, 22458379, 23247987, 23715780, 24177421, 25418473, 26654598, 29843638, 29886073, 31156630, 31277942, 31601783, 9122044		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20862745, 29311118		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30306428		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20635389	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22458379, 28810656, 29886073		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22458379	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21990365		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30453650		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602, 17640669, 19143056, 24177421		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30123050		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	9508209		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29507108		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21990323		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21990323		★☆☆☆☆ Found in Text Mining only