Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28976
Gene name	Acyl-CoA dehydrogenase family member 9
Gene symbol	ACAD9
Synonyms (NCBI Gene)	MC1DN20NPD002
Chromosome	3
Chromosome location	3q21.3
Summary	This gene encodes a member of the acyl-CoA dehydrogenase family. Members of this family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. The encoded protein is specifically active toward

Show/Hide all (21)

SNP ID	Visualize variation	Clinical significance	Consequence
rs115532916	G>A,C	Pathogenic, conflicting-interpretations-of-pathogenicity, benign	Non coding transcript variant, missense variant, coding sequence variant
rs146453758	C>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs149753643	G>A	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs368949613	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs370266841	G>A	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs387907041	T>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs387907042	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs753711253	C>T	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs761102100	G>A,C	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs762521317	C>T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs773586510	G>A,T	Likely-pathogenic, pathogenic	Splice acceptor variant
rs773949927	A>G,T	Pathogenic	Non coding transcript variant, missense variant, initiator codon variant, 5 prime UTR variant
rs777282696	C>A,T	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs781156571	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs863224844	T>-	Pathogenic, likely-pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs863225056	T>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs863225057	T>G	Pathogenic	Missense variant, initiator codon variant, non coding transcript variant, 5 prime UTR variant
rs863225058	A>G,T	Pathogenic	Splice acceptor variant, intron variant
rs1553730947	AAGACTG>CAGTAAAACATC	Likely-pathogenic	Inframe indel, non coding transcript variant, stop gained, coding sequence variant
rs1576344664	C>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1576347955	->GACTA	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040112	hsa-miR-615-3p	CLASH	23622248
MIRT2165753	hsa-miR-103a	CLIP-seq
MIRT2165754	hsa-miR-107	CLIP-seq
MIRT2165755	hsa-miR-1228	CLIP-seq
MIRT2165756	hsa-miR-15a	CLIP-seq
MIRT2165757	hsa-miR-15b	CLIP-seq
MIRT2165758	hsa-miR-16	CLIP-seq
MIRT2165759	hsa-miR-1827	CLIP-seq
MIRT2165760	hsa-miR-195	CLIP-seq
MIRT2165761	hsa-miR-3612	CLIP-seq
MIRT2165762	hsa-miR-3620	CLIP-seq
MIRT2165763	hsa-miR-3646	CLIP-seq
MIRT2165764	hsa-miR-3692	CLIP-seq
MIRT2165765	hsa-miR-424	CLIP-seq
MIRT2165766	hsa-miR-4254	CLIP-seq
MIRT2165767	hsa-miR-4279	CLIP-seq
MIRT2165768	hsa-miR-4308	CLIP-seq
MIRT2165769	hsa-miR-4323	CLIP-seq
MIRT2165770	hsa-miR-4436b-5p	CLIP-seq
MIRT2165771	hsa-miR-4443	CLIP-seq
MIRT2165772	hsa-miR-497	CLIP-seq
MIRT2165773	hsa-miR-650	CLIP-seq
MIRT2442999	hsa-miR-1323	CLIP-seq
MIRT2443000	hsa-miR-2467-5p	CLIP-seq
MIRT2443001	hsa-miR-490-3p	CLIP-seq
MIRT2443002	hsa-miR-548o	CLIP-seq
MIRT2443003	hsa-miR-619	CLIP-seq
MIRT2443004	hsa-miR-7	CLIP-seq
MIRT2442999	hsa-miR-1323	CLIP-seq
MIRT2443000	hsa-miR-2467-5p	CLIP-seq
MIRT2443001	hsa-miR-490-3p	CLIP-seq
MIRT2443002	hsa-miR-548o	CLIP-seq
MIRT2443003	hsa-miR-619	CLIP-seq
MIRT2443004	hsa-miR-7	CLIP-seq
MIRT2165753	hsa-miR-103a	CLIP-seq
MIRT2165754	hsa-miR-107	CLIP-seq
MIRT2468360	hsa-miR-1224-3p	CLIP-seq
MIRT2165755	hsa-miR-1228	CLIP-seq
MIRT2165756	hsa-miR-15a	CLIP-seq
MIRT2165757	hsa-miR-15b	CLIP-seq
MIRT2165758	hsa-miR-16	CLIP-seq
MIRT2165759	hsa-miR-1827	CLIP-seq
MIRT2165760	hsa-miR-195	CLIP-seq
MIRT2468361	hsa-miR-342-3p	CLIP-seq
MIRT2165761	hsa-miR-3612	CLIP-seq
MIRT2165762	hsa-miR-3620	CLIP-seq
MIRT2165764	hsa-miR-3692	CLIP-seq
MIRT2165765	hsa-miR-424	CLIP-seq
MIRT2165766	hsa-miR-4254	CLIP-seq
MIRT2468362	hsa-miR-4258	CLIP-seq
MIRT2165767	hsa-miR-4279	CLIP-seq
MIRT2468363	hsa-miR-4286	CLIP-seq
MIRT2165768	hsa-miR-4308	CLIP-seq
MIRT2165769	hsa-miR-4323	CLIP-seq
MIRT2165770	hsa-miR-4436b-5p	CLIP-seq
MIRT2165771	hsa-miR-4443	CLIP-seq
MIRT2468364	hsa-miR-4685-5p	CLIP-seq
MIRT2468365	hsa-miR-4768-5p	CLIP-seq
MIRT2165772	hsa-miR-497	CLIP-seq
MIRT2468366	hsa-miR-545	CLIP-seq
MIRT2468367	hsa-miR-642b	CLIP-seq
MIRT2165773	hsa-miR-650	CLIP-seq
MIRT2165753	hsa-miR-103a	CLIP-seq
MIRT2165754	hsa-miR-107	CLIP-seq
MIRT2468360	hsa-miR-1224-3p	CLIP-seq
MIRT2165755	hsa-miR-1228	CLIP-seq
MIRT2165756	hsa-miR-15a	CLIP-seq
MIRT2165757	hsa-miR-15b	CLIP-seq
MIRT2165758	hsa-miR-16	CLIP-seq
MIRT2165759	hsa-miR-1827	CLIP-seq
MIRT2165760	hsa-miR-195	CLIP-seq
MIRT2468361	hsa-miR-342-3p	CLIP-seq
MIRT2165761	hsa-miR-3612	CLIP-seq
MIRT2165762	hsa-miR-3620	CLIP-seq
MIRT2165764	hsa-miR-3692	CLIP-seq
MIRT2165765	hsa-miR-424	CLIP-seq
MIRT2165766	hsa-miR-4254	CLIP-seq
MIRT2468362	hsa-miR-4258	CLIP-seq
MIRT2165767	hsa-miR-4279	CLIP-seq
MIRT2468363	hsa-miR-4286	CLIP-seq
MIRT2165768	hsa-miR-4308	CLIP-seq
MIRT2165769	hsa-miR-4323	CLIP-seq
MIRT2165770	hsa-miR-4436b-5p	CLIP-seq
MIRT2165771	hsa-miR-4443	CLIP-seq
MIRT2468364	hsa-miR-4685-5p	CLIP-seq
MIRT2468365	hsa-miR-4768-5p	CLIP-seq
MIRT2165772	hsa-miR-497	CLIP-seq
MIRT2468366	hsa-miR-545	CLIP-seq
MIRT2468367	hsa-miR-642b	CLIP-seq
MIRT2165773	hsa-miR-650	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	16020546
GO:0003995	Function	Acyl-CoA dehydrogenase activity	IBA
GO:0003995	Function	Acyl-CoA dehydrogenase activity	IEA
GO:0004466	Function	Long-chain fatty acyl-CoA dehydrogenase activity	IDA	16020546
GO:0004466	Function	Long-chain fatty acyl-CoA dehydrogenase activity	IEA
GO:0005515	Function	Protein binding	IPI	20816094, 32320651, 33753518
GO:0005634	Component	Nucleus	IDA	21237683
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	16020546, 20816094
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	32320651
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016627	Function	Oxidoreductase activity, acting on the CH-CH group of donors	IEA
GO:0030425	Component	Dendrite	IDA	21237683
GO:0031966	Component	Mitochondrial membrane	IDA	16020546
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	IMP	20816094
GO:0032981	Process	Mitochondrial respiratory chain complex I assembly	NAS	32320651
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0051791	Process	Medium-chain fatty acid metabolic process	IDA	16020546
GO:0070991	Function	Medium-chain fatty acyl-CoA dehydrogenase activity	IDA	16020546

MIM	HGNC	e!Ensembl
611103	21497	ENSG00000177646

Q9H845

Protein name

Complex I assembly factor ACAD9, mitochondrial (Acyl-CoA dehydrogenase family member 9) (ACAD-9) (EC 1.3.8.-)

Protein function

As part of the MCIA complex, primarily participates in the assembly of the mitochondrial complex I and therefore plays a role in oxidative phosphorylation (PubMed:20816094, PubMed:24158852, PubMed:32320651). This moonlighting protein also has a

PDB

8PHE , 8PHF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02771	Acyl-CoA_dh_N	65 → 173	Acyl-CoA dehydrogenase, N-terminal domain	Domain
PF02770	Acyl-CoA_dh_M	177 → 278	Acyl-CoA dehydrogenase, middle domain	Domain
PF00441	Acyl-CoA_dh_1	290 → 441	Acyl-CoA dehydrogenase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in most normal human tissues and cancer cell lines with high level of expression in heart, skeletal muscles, brain, kidney and liver (PubMed:12359260). In the cerebellum uniquely expressed in the granular layer (

Sequence

MSGCGLFLRTTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVS
QDELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGF
SNTMYSRLGEIISMDGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCL
TEPASGSDAASIRSRATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKD
KITAFIVERDFGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNIL
NSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMT
YLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR
ILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVD
LGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINL
YGMTAVLSRASRSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKK
VSQQILEKRAYICAHPLDRTC

Sequence length

621

Interactions

View interactions

	Reactome
			Complex I biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ACAD9-related disorder	Likely pathogenic; Pathogenic	rs753711253, rs150283105	RCV004755828 RCV003391001	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acyl-CoA dehydrogenase 9 deficiency	Pathogenic; Likely pathogenic	rs766305690, rs1935194749, rs750089899, rs148694290, rs2107657717, rs1314818291, rs781043714, rs763004980, rs2107653861, rs2107655510, rs773949927, rs2107648799, rs777282696, rs2107664575, rs2107656502 View all (82 more)	RCV001333000 RCV001335613 RCV001831359 RCV003469743 RCV003469731 View all (96 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial complex I deficiency	Likely pathogenic; Pathogenic	rs2107657797, rs777282696, rs2107664575, rs2529261830, rs2529262095, rs863224844, rs753711253, rs149753643, rs150283105, rs2529107329, rs1012004126, rs368949613, rs115532916, rs377022708, rs766026673	RCV002307793 RCV004579582 RCV002509733 RCV002302539 RCV004587398 View all (10 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Possible mitochondrial disorder - nuclear genes	Likely pathogenic; Pathogenic	rs115532916	RCV005865087	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 20	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	27483465, 30025539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acyl-CoA dehydrogenase 9 deficiency	Acyl CoA Dehydrogenase Deficiency	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Acyl-CoA Dehydrogenase Family, Member 9, Deficiency of	Acyl CoA Dehydrogenase Deficiency	CLINGEN_DG	12359260, 16020546, 16750164, 17564966, 20816094, 21057504, 22499348, 25721401, 26669660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acyl-CoA Dehydrogenase Family, Member 9, Deficiency of	Acyl CoA Dehydrogenase Deficiency	ORPHANET_DG	17564966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acyl-CoA Dehydrogenase Family, Member 9, Deficiency of	Acyl CoA Dehydrogenase Deficiency	GENOMICS_ENGLAND_DG	21057504, 27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acyl-CoA Dehydrogenase Family, Member 9, Deficiency of	Acyl CoA Dehydrogenase Deficiency	BEFREE	25721401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acyl-CoA Dehydrogenase Family, Member 9, Deficiency of	Acyl CoA Dehydrogenase Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	26669660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	17564966, 30025539, 37240454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26826406, 30025539, 31473688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30025539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28529009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28529009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37388727	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	27483465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37388727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	23836383, 26669660, 27483465, 29348607	Associate	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 20	Mitochondrial Complex Deficiency	GENOMICS_ENGLAND_DG	17564966, 21057504, 25929793, 27604308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 20	Mitochondrial Complex Deficiency	UNIPROT_DG	17564966, 20816094, 20929961, 21057504, 22499348, 23836383, 23996478, 26741492		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 20	Mitochondrial Complex Deficiency	CLINVAR_DG	25326637, 25721401, 26669660, 28529009, 30025539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	22231380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26669660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	BEFREE	23836383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	Pubtator	23836383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenias	Myasthenia Gravis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	27438479		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27233227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	26669660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23939409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	27233227		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACAD9 (acyl-CoA dehydrogenase family member 9)