Gene Gene information from NCBI Gene database.
Entrez ID 28973
Gene name Mitochondrial ribosomal protein S18B
Gene symbol MRPS18B
Synonyms (NCBI Gene)
C6orf14HSPC183HumanS18aMRP-S18-2MRPS18-2PTD017S18amtmS40
Chromosome 6
Chromosome location 6p21.33
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
230
miRTarBase ID miRNA Experiments Reference
MIRT029306 hsa-miR-26b-5p Microarray 19088304
MIRT041787 hsa-miR-484 CLASH 23622248
MIRT040153 hsa-miR-615-3p CLASH 23622248
MIRT317415 hsa-miR-548e-5p PAR-CLIP 20371350
MIRT317412 hsa-miR-320a PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IEA
GO:0003735 Function Structural constituent of ribosome ISS 11402041
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005515 Function Protein binding IPI 18391203, 22003127, 28514442, 30021884, 32296183, 33961781
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611982 14516 ENSG00000204568
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y676
Protein name Small ribosomal subunit protein mS40 (28S ribosomal protein S18-2, mitochondrial) (MRP-S18-2) (28S ribosomal protein S18b, mitochondrial) (MRP-S18-b) (Mrps18-b) (S18mt-b) (Small ribosomal subunit protein bS18b)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01084 Ribosomal_S18 111 163 Ribosomal protein S18 Family
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLL
IYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
Sequence length 258
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Viral carcinogenesis   Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NEUROBLASTOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis, Psoriatic Psoriatic Arthritis GWASCAT_DG 30552173
★☆☆☆☆
Found in Text Mining only
Endometrial Carcinoma Endometrial carcinoma BEFREE 29396484
★☆☆☆☆
Found in Text Mining only
Hereditary Diffuse Gastric Cancer Gastric Cancer CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 29104783
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of endometrium Endometrial Cancer BEFREE 29396484
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms CTD_human_DG 21364753
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Neuroblastoma Pubtator 32599975 Stimulate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Pleural Diseases Pleural diseases Pubtator 32365959 Associate
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Prostatic Neoplasms BEFREE 29396484
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Stomach Neoplasms CTD_human_DG 21364753
★★☆☆☆
Found in Text Mining + Unknown/Other Associations