Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28972
Gene name	Signal peptidase complex subunit 1
Gene symbol	SPCS1
Synonyms (NCBI Gene)	HSPC033SPC1SPC12YJR010C-A
Chromosome	3
Chromosome location	3p21.1

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020721	hsa-miR-155-5p	Proteomics	18668040
MIRT641713	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT641712	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT641711	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT641710	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT641709	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT641708	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT641707	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT641706	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT641705	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT641704	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT641703	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT641702	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT641701	hsa-miR-302e	HITS-CLIP	23824327
MIRT641700	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT641699	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT641698	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT641697	hsa-miR-520b	HITS-CLIP	23824327
MIRT641696	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT641695	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT641694	hsa-miR-520e	HITS-CLIP	23824327
MIRT641693	hsa-miR-512-3p	HITS-CLIP	23824327
MIRT641692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT641691	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT641689	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT641690	hsa-miR-1976	HITS-CLIP	23824327
MIRT641688	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT641687	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT641685	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT641686	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT519289	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT519288	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT519287	hsa-miR-4794	PAR-CLIP	23446348
MIRT519286	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT519285	hsa-miR-6069	PAR-CLIP	23446348
MIRT519284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT519283	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT519281	hsa-miR-3674	PAR-CLIP	23446348
MIRT519282	hsa-miR-3149	PAR-CLIP	23446348
MIRT519280	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT641713	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT641712	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT641711	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT641710	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT641709	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT641708	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT641707	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT641706	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT641705	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT641704	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT641703	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT641702	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT641701	hsa-miR-302e	HITS-CLIP	23824327
MIRT641700	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT641699	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT641698	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT641697	hsa-miR-520b	HITS-CLIP	23824327
MIRT641696	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT641695	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT641694	hsa-miR-520e	HITS-CLIP	23824327
MIRT641693	hsa-miR-512-3p	HITS-CLIP	23824327
MIRT641692	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT641691	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT641689	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT641690	hsa-miR-1976	HITS-CLIP	23824327
MIRT641688	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT641687	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT641685	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT641686	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT519289	hsa-miR-1228-3p	PAR-CLIP	23446348
MIRT519288	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT519287	hsa-miR-4794	PAR-CLIP	23446348
MIRT519286	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT519285	hsa-miR-6069	PAR-CLIP	23446348
MIRT519284	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT519283	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT519281	hsa-miR-3674	PAR-CLIP	23446348
MIRT519282	hsa-miR-3149	PAR-CLIP	23446348
MIRT519280	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT1383161	hsa-miR-1227	CLIP-seq
MIRT1383162	hsa-miR-1276	CLIP-seq
MIRT1383163	hsa-miR-1284	CLIP-seq
MIRT1383164	hsa-miR-142-5p	CLIP-seq
MIRT1383165	hsa-miR-146a	CLIP-seq
MIRT1383166	hsa-miR-146b-5p	CLIP-seq
MIRT1383167	hsa-miR-147	CLIP-seq
MIRT1383168	hsa-miR-2355-5p	CLIP-seq
MIRT1383169	hsa-miR-340	CLIP-seq
MIRT1383170	hsa-miR-3646	CLIP-seq
MIRT1383171	hsa-miR-378g	CLIP-seq
MIRT1383172	hsa-miR-3925-5p	CLIP-seq
MIRT1383173	hsa-miR-4311	CLIP-seq
MIRT1383174	hsa-miR-4330	CLIP-seq
MIRT1383175	hsa-miR-4652-3p	CLIP-seq
MIRT1383176	hsa-miR-4672	CLIP-seq
MIRT1383177	hsa-miR-4789-5p	CLIP-seq
MIRT1383178	hsa-miR-485-3p	CLIP-seq
MIRT1383179	hsa-miR-581	CLIP-seq
MIRT1383180	hsa-miR-583	CLIP-seq
MIRT2114573	hsa-miR-3126-3p	CLIP-seq
MIRT2114574	hsa-miR-4667-5p	CLIP-seq
MIRT2114575	hsa-miR-4700-5p	CLIP-seq
MIRT2114576	hsa-miR-637	CLIP-seq
MIRT1383161	hsa-miR-1227	CLIP-seq
MIRT1383167	hsa-miR-147	CLIP-seq
MIRT2631018	hsa-miR-3163	CLIP-seq
MIRT1383169	hsa-miR-340	CLIP-seq
MIRT2631019	hsa-miR-3662	CLIP-seq
MIRT2631020	hsa-miR-3665	CLIP-seq
MIRT2631021	hsa-miR-3978	CLIP-seq
MIRT2631022	hsa-miR-4261	CLIP-seq
MIRT2631023	hsa-miR-4325	CLIP-seq
MIRT1383175	hsa-miR-4652-3p	CLIP-seq
MIRT2631024	hsa-miR-4764-3p	CLIP-seq
MIRT1383178	hsa-miR-485-3p	CLIP-seq
MIRT2631025	hsa-miR-494	CLIP-seq
MIRT2631026	hsa-miR-522	CLIP-seq
MIRT2631027	hsa-miR-548a-3p	CLIP-seq
MIRT2631028	hsa-miR-548e	CLIP-seq
MIRT2631029	hsa-miR-548f	CLIP-seq
MIRT2631030	hsa-miR-570	CLIP-seq
MIRT1383179	hsa-miR-581	CLIP-seq
MIRT2631031	hsa-miR-764	CLIP-seq
MIRT2631018	hsa-miR-3163	CLIP-seq
MIRT1383169	hsa-miR-340	CLIP-seq
MIRT2631020	hsa-miR-3665	CLIP-seq
MIRT2631027	hsa-miR-548a-3p	CLIP-seq
MIRT2631028	hsa-miR-548e	CLIP-seq
MIRT2631029	hsa-miR-548f	CLIP-seq
MIRT2631030	hsa-miR-570	CLIP-seq
MIRT2631031	hsa-miR-764	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24009510, 29593046, 34388369
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005787	Component	Signal peptidase complex	IBA
GO:0005787	Component	Signal peptidase complex	IEA
GO:0005787	Component	Signal peptidase complex	IPI	34388369
GO:0005787	Component	Signal peptidase complex	TAS	8632014
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	8632014, 34388369
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006465	Process	Signal peptide processing	IBA
GO:0006465	Process	Signal peptide processing	IDA	34388369
GO:0006465	Process	Signal peptide processing	IEA
GO:0006508	Process	Proteolysis	TAS	8632014
GO:0016020	Component	Membrane	IEA
GO:0019068	Process	Virion assembly	IMP	24009510, 29593046
GO:0019082	Process	Viral protein processing	IMP	27383988
GO:0045047	Process	Protein targeting to ER	IBA

MIM	HGNC	e!Ensembl
610358	23401	ENSG00000114902

Q9Y6A9

Protein name

Signal peptidase complex subunit 1 (Microsomal signal peptidase 12 kDa subunit) (SPase 12 kDa subunit)

Protein function

Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:34388369). Dispensable for SPC enzymat

PDB

7P2P , 7P2Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06645	SPC12	12 → 82	Microsomal signal peptidase 12 kDa subunit (SPC12)	Family

Sequence

MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALS
CPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVM
AGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

Sequence length

169

Interactions

View interactions

	KEGG		Reactome
	Protein export		Synthesis, secretion, and deacylation of Ghrelin

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	22182935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24886551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	22472876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35192775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24886551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	29942097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29942097		★★★★★ ★☆☆☆☆ Found in Text Mining only

SPCS1 (signal peptidase complex subunit 1)