Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	28969
Gene name	Basic leucine zipper and W2 domains 2
Gene symbol	BZW2
Synonyms (NCBI Gene)	5MP1HSPC028MST017MSTP017
Chromosome	7
Chromosome location	7p21.1

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032241	hsa-let-7b-5p	Proteomics	18668040
MIRT045798	hsa-miR-191-5p	CLASH	23622248
MIRT734919	hsa-let-7a-5p	Luciferase reporter assayWestern blottingqRT-PCR	33273832
MIRT828036	hsa-miR-1267	CLIP-seq
MIRT828037	hsa-miR-135a	CLIP-seq
MIRT828038	hsa-miR-135b	CLIP-seq
MIRT828039	hsa-miR-147	CLIP-seq
MIRT828040	hsa-miR-218	CLIP-seq
MIRT828041	hsa-miR-3119	CLIP-seq
MIRT828042	hsa-miR-3173-3p	CLIP-seq
MIRT828043	hsa-miR-3174	CLIP-seq
MIRT828044	hsa-miR-331-5p	CLIP-seq
MIRT828045	hsa-miR-3613-3p	CLIP-seq
MIRT828046	hsa-miR-3650	CLIP-seq
MIRT828047	hsa-miR-3911	CLIP-seq
MIRT828048	hsa-miR-4294	CLIP-seq
MIRT828049	hsa-miR-4536	CLIP-seq
MIRT828050	hsa-miR-4678	CLIP-seq
MIRT828051	hsa-miR-4765	CLIP-seq
MIRT828052	hsa-miR-4790-3p	CLIP-seq
MIRT828053	hsa-miR-4796-3p	CLIP-seq
MIRT828054	hsa-miR-548t	CLIP-seq
MIRT828055	hsa-miR-636	CLIP-seq
MIRT828056	hsa-miR-644	CLIP-seq
MIRT828057	hsa-miR-653	CLIP-seq
MIRT828058	hsa-miR-765	CLIP-seq
MIRT828059	hsa-miR-921	CLIP-seq
MIRT828060	hsa-let-7a	CLIP-seq
MIRT828061	hsa-let-7b	CLIP-seq
MIRT828062	hsa-let-7c	CLIP-seq
MIRT828063	hsa-let-7d	CLIP-seq
MIRT828064	hsa-let-7e	CLIP-seq
MIRT828065	hsa-let-7f	CLIP-seq
MIRT828066	hsa-let-7g	CLIP-seq
MIRT828067	hsa-let-7i	CLIP-seq
MIRT828068	hsa-miR-105	CLIP-seq
MIRT828069	hsa-miR-1179	CLIP-seq
MIRT828070	hsa-miR-1236	CLIP-seq
MIRT828071	hsa-miR-1266	CLIP-seq
MIRT828036	hsa-miR-1267	CLIP-seq
MIRT828037	hsa-miR-135a	CLIP-seq
MIRT828038	hsa-miR-135b	CLIP-seq
MIRT828039	hsa-miR-147	CLIP-seq
MIRT828041	hsa-miR-3119	CLIP-seq
MIRT828042	hsa-miR-3173-3p	CLIP-seq
MIRT828043	hsa-miR-3174	CLIP-seq
MIRT828045	hsa-miR-3613-3p	CLIP-seq
MIRT828046	hsa-miR-3650	CLIP-seq
MIRT828072	hsa-miR-369-3p	CLIP-seq
MIRT828073	hsa-miR-371-5p	CLIP-seq
MIRT828074	hsa-miR-371b-5p	CLIP-seq
MIRT828075	hsa-miR-374a	CLIP-seq
MIRT828076	hsa-miR-374b	CLIP-seq
MIRT828047	hsa-miR-3911	CLIP-seq
MIRT828077	hsa-miR-3927	CLIP-seq
MIRT828078	hsa-miR-3942-3p	CLIP-seq
MIRT828079	hsa-miR-4291	CLIP-seq
MIRT828048	hsa-miR-4294	CLIP-seq
MIRT828080	hsa-miR-4310	CLIP-seq
MIRT828081	hsa-miR-4451	CLIP-seq
MIRT828082	hsa-miR-4458	CLIP-seq
MIRT828083	hsa-miR-4480	CLIP-seq
MIRT828084	hsa-miR-4500	CLIP-seq
MIRT828085	hsa-miR-4518	CLIP-seq
MIRT828049	hsa-miR-4536	CLIP-seq
MIRT828086	hsa-miR-4729	CLIP-seq
MIRT828087	hsa-miR-4753-3p	CLIP-seq
MIRT828051	hsa-miR-4765	CLIP-seq
MIRT828088	hsa-miR-4768-5p	CLIP-seq
MIRT828089	hsa-miR-4775	CLIP-seq
MIRT828090	hsa-miR-4786-3p	CLIP-seq
MIRT828052	hsa-miR-4790-3p	CLIP-seq
MIRT828053	hsa-miR-4796-3p	CLIP-seq
MIRT828091	hsa-miR-496	CLIP-seq
MIRT828092	hsa-miR-513c	CLIP-seq
MIRT828093	hsa-miR-514b-5p	CLIP-seq
MIRT828094	hsa-miR-522	CLIP-seq
MIRT828054	hsa-miR-548t	CLIP-seq
MIRT828056	hsa-miR-644	CLIP-seq
MIRT828057	hsa-miR-653	CLIP-seq
MIRT828058	hsa-miR-765	CLIP-seq
MIRT828059	hsa-miR-921	CLIP-seq
MIRT828095	hsa-miR-942	CLIP-seq
MIRT828096	hsa-miR-98	CLIP-seq
MIRT1945015	hsa-miR-101	CLIP-seq
MIRT1945016	hsa-miR-197	CLIP-seq
MIRT1945017	hsa-miR-3151	CLIP-seq
MIRT1945018	hsa-miR-3180	CLIP-seq
MIRT1945019	hsa-miR-3180-3p	CLIP-seq
MIRT1945020	hsa-miR-3196	CLIP-seq
MIRT1945016	hsa-miR-197	CLIP-seq
MIRT2183495	hsa-miR-2054	CLIP-seq
MIRT1945017	hsa-miR-3151	CLIP-seq
MIRT1945018	hsa-miR-3180	CLIP-seq
MIRT1945019	hsa-miR-3180-3p	CLIP-seq
MIRT1945020	hsa-miR-3196	CLIP-seq
MIRT2183496	hsa-miR-3677-5p	CLIP-seq
MIRT828053	hsa-miR-4796-3p	CLIP-seq
MIRT2183497	hsa-miR-520g	CLIP-seq
MIRT2183498	hsa-miR-520h	CLIP-seq
MIRT828060	hsa-let-7a	CLIP-seq
MIRT828061	hsa-let-7b	CLIP-seq
MIRT828062	hsa-let-7c	CLIP-seq
MIRT828063	hsa-let-7d	CLIP-seq
MIRT828064	hsa-let-7e	CLIP-seq
MIRT828065	hsa-let-7f	CLIP-seq
MIRT828066	hsa-let-7g	CLIP-seq
MIRT828067	hsa-let-7i	CLIP-seq
MIRT828071	hsa-miR-1266	CLIP-seq
MIRT2487140	hsa-miR-136	CLIP-seq
MIRT2487141	hsa-miR-3121-5p	CLIP-seq
MIRT2487142	hsa-miR-3127-5p	CLIP-seq
MIRT2487143	hsa-miR-3130-3p	CLIP-seq
MIRT828072	hsa-miR-369-3p	CLIP-seq
MIRT828075	hsa-miR-374a	CLIP-seq
MIRT828076	hsa-miR-374b	CLIP-seq
MIRT2487144	hsa-miR-3918	CLIP-seq
MIRT828077	hsa-miR-3927	CLIP-seq
MIRT2487145	hsa-miR-4287	CLIP-seq
MIRT828081	hsa-miR-4451	CLIP-seq
MIRT2487146	hsa-miR-4457	CLIP-seq
MIRT828082	hsa-miR-4458	CLIP-seq
MIRT2487147	hsa-miR-4469	CLIP-seq
MIRT828084	hsa-miR-4500	CLIP-seq
MIRT828085	hsa-miR-4518	CLIP-seq
MIRT2487148	hsa-miR-4685-3p	CLIP-seq
MIRT2487149	hsa-miR-4713-5p	CLIP-seq
MIRT2487150	hsa-miR-4793-3p	CLIP-seq
MIRT2487151	hsa-miR-548aa	CLIP-seq
MIRT2487152	hsa-miR-548ac	CLIP-seq
MIRT2487153	hsa-miR-548ae	CLIP-seq
MIRT2487154	hsa-miR-548aj	CLIP-seq
MIRT2487155	hsa-miR-548am	CLIP-seq
MIRT2487156	hsa-miR-548d-3p	CLIP-seq
MIRT2487157	hsa-miR-548x	CLIP-seq
MIRT2487158	hsa-miR-548z	CLIP-seq
MIRT2487159	hsa-miR-642a	CLIP-seq
MIRT2487160	hsa-miR-671-5p	CLIP-seq
MIRT828096	hsa-miR-98	CLIP-seq
MIRT828060	hsa-let-7a	CLIP-seq
MIRT828061	hsa-let-7b	CLIP-seq
MIRT828062	hsa-let-7c	CLIP-seq
MIRT828063	hsa-let-7d	CLIP-seq
MIRT828064	hsa-let-7e	CLIP-seq
MIRT828065	hsa-let-7f	CLIP-seq
MIRT828066	hsa-let-7g	CLIP-seq
MIRT828067	hsa-let-7i	CLIP-seq
MIRT828071	hsa-miR-1266	CLIP-seq
MIRT2487140	hsa-miR-136	CLIP-seq
MIRT2487141	hsa-miR-3121-5p	CLIP-seq
MIRT2487142	hsa-miR-3127-5p	CLIP-seq
MIRT2487143	hsa-miR-3130-3p	CLIP-seq
MIRT828072	hsa-miR-369-3p	CLIP-seq
MIRT828075	hsa-miR-374a	CLIP-seq
MIRT828076	hsa-miR-374b	CLIP-seq
MIRT2487144	hsa-miR-3918	CLIP-seq
MIRT828077	hsa-miR-3927	CLIP-seq
MIRT2487145	hsa-miR-4287	CLIP-seq
MIRT828081	hsa-miR-4451	CLIP-seq
MIRT2487146	hsa-miR-4457	CLIP-seq
MIRT828082	hsa-miR-4458	CLIP-seq
MIRT2487147	hsa-miR-4469	CLIP-seq
MIRT828084	hsa-miR-4500	CLIP-seq
MIRT2676246	hsa-miR-450a	CLIP-seq
MIRT828085	hsa-miR-4518	CLIP-seq
MIRT2487148	hsa-miR-4685-3p	CLIP-seq
MIRT2487149	hsa-miR-4713-5p	CLIP-seq
MIRT828090	hsa-miR-4786-3p	CLIP-seq
MIRT2487150	hsa-miR-4793-3p	CLIP-seq
MIRT2487151	hsa-miR-548aa	CLIP-seq
MIRT2487152	hsa-miR-548ac	CLIP-seq
MIRT2487153	hsa-miR-548ae	CLIP-seq
MIRT2487154	hsa-miR-548aj	CLIP-seq
MIRT2487155	hsa-miR-548am	CLIP-seq
MIRT2487156	hsa-miR-548d-3p	CLIP-seq
MIRT2487157	hsa-miR-548x	CLIP-seq
MIRT2487158	hsa-miR-548z	CLIP-seq
MIRT2676247	hsa-miR-570	CLIP-seq
MIRT2487159	hsa-miR-642a	CLIP-seq
MIRT2487160	hsa-miR-671-5p	CLIP-seq
MIRT828096	hsa-miR-98	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21745818, 25147208
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21745818, 25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IDA	21745818, 28981728, 29470543, 34260931
GO:0006446	Process	Regulation of translational initiation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0045296	Function	Cadherin binding	HDA	25468996

MIM	HGNC	e!Ensembl
619275	18808	ENSG00000136261

Q9Y6E2

Protein name

eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2)

Protein function

Translation initiation regulator which represses non-AUG initiated translation and repeat-associated non-AUG (RAN) initiated translation by acting as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5) function (PubMed:2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02020	W2	338 → 415	eIF4-gamma/eIF5/eIF2-epsilon	Family

Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD
YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR
RYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKE
GIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLK
ELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC
IMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAF
QKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Sequence length

419

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38538258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31175057, 31643092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37067340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35232999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30805927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30932331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36608137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31643092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28791373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38538258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BZW2 (basic leucine zipper and W2 domains 2)