Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	28964
Gene name	GIT ArfGAP 1
Gene symbol	GIT1
Synonyms (NCBI Gene)	p95-APP1
Chromosome	17
Chromosome location	17q11.2

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025756	hsa-miR-7-5p	Microarray	19073608
MIRT042200	hsa-miR-484	CLASH	23622248
MIRT054625	hsa-miR-149-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24608434
MIRT054625	hsa-miR-149-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24608434
MIRT438167	hsa-miR-491-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24335959
MIRT438167	hsa-miR-491-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24335959
MIRT438167	hsa-miR-491-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24335959
MIRT438167	hsa-miR-491-5p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24335959
MIRT731825	hsa-miR-34c-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	27698902
MIRT731825	hsa-miR-34c-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	27698902
MIRT732112	hsa-miR-125a-3p	Luciferase reporter assayqRT-PCRWestern blot	28101188
MIRT732112	hsa-miR-125a-3p	Luciferase reporter assayqRT-PCRWestern blot	28101188
MIRT1019448	hsa-miR-138	CLIP-seq
MIRT1019449	hsa-miR-3173-3p	CLIP-seq
MIRT1019450	hsa-miR-361-3p	CLIP-seq
MIRT1019451	hsa-miR-3688-5p	CLIP-seq
MIRT1019452	hsa-miR-3943	CLIP-seq
MIRT1019453	hsa-miR-4313	CLIP-seq
MIRT1019454	hsa-miR-4456	CLIP-seq
MIRT1019455	hsa-miR-4492	CLIP-seq
MIRT1019456	hsa-miR-4498	CLIP-seq
MIRT1019457	hsa-miR-4690-3p	CLIP-seq
MIRT1019458	hsa-miR-4779	CLIP-seq
MIRT1019459	hsa-miR-520d-5p	CLIP-seq
MIRT1019460	hsa-miR-524-5p	CLIP-seq
MIRT1019461	hsa-miR-548v	CLIP-seq
MIRT1019462	hsa-miR-644	CLIP-seq
MIRT1019463	hsa-miR-762	CLIP-seq
MIRT1019464	hsa-miR-885-3p	CLIP-seq
MIRT1019465	hsa-miR-1207-3p	CLIP-seq
MIRT1019466	hsa-miR-1207-5p	CLIP-seq
MIRT1019467	hsa-miR-1286	CLIP-seq
MIRT1019468	hsa-miR-1321	CLIP-seq
MIRT1019469	hsa-miR-1827	CLIP-seq
MIRT1019470	hsa-miR-2277-3p	CLIP-seq
MIRT1019471	hsa-miR-3612	CLIP-seq
MIRT1019472	hsa-miR-4270	CLIP-seq
MIRT1019473	hsa-miR-4441	CLIP-seq
MIRT1019474	hsa-miR-4462	CLIP-seq
MIRT1019475	hsa-miR-4652-5p	CLIP-seq
MIRT1019457	hsa-miR-4690-3p	CLIP-seq
MIRT1019476	hsa-miR-4691-3p	CLIP-seq
MIRT1019477	hsa-miR-4728-5p	CLIP-seq
MIRT1019478	hsa-miR-4736	CLIP-seq
MIRT1019479	hsa-miR-4739	CLIP-seq
MIRT1019480	hsa-miR-4756-5p	CLIP-seq
MIRT1019481	hsa-miR-4763-3p	CLIP-seq
MIRT1019482	hsa-miR-4772-5p	CLIP-seq
MIRT1019483	hsa-miR-512-5p	CLIP-seq
MIRT1019484	hsa-miR-650	CLIP-seq
MIRT2001896	hsa-miR-122	CLIP-seq
MIRT2001897	hsa-miR-1245	CLIP-seq
MIRT2001898	hsa-miR-1294	CLIP-seq
MIRT2001899	hsa-miR-1296	CLIP-seq
MIRT1019448	hsa-miR-138	CLIP-seq
MIRT2001900	hsa-miR-140-3p	CLIP-seq
MIRT2001901	hsa-miR-1910	CLIP-seq
MIRT2001902	hsa-miR-1915	CLIP-seq
MIRT2001903	hsa-miR-196a	CLIP-seq
MIRT2001904	hsa-miR-196b	CLIP-seq
MIRT2001905	hsa-miR-214	CLIP-seq
MIRT1019470	hsa-miR-2277-3p	CLIP-seq
MIRT2001906	hsa-miR-24	CLIP-seq
MIRT2001907	hsa-miR-2467-3p	CLIP-seq
MIRT2001908	hsa-miR-2861	CLIP-seq
MIRT2001909	hsa-miR-3136-3p	CLIP-seq
MIRT2001910	hsa-miR-3176	CLIP-seq
MIRT2001911	hsa-miR-3185	CLIP-seq
MIRT2001912	hsa-miR-3202	CLIP-seq
MIRT2001913	hsa-miR-346	CLIP-seq
MIRT1019450	hsa-miR-361-3p	CLIP-seq
MIRT2001914	hsa-miR-3614-3p	CLIP-seq
MIRT2001915	hsa-miR-3619-5p	CLIP-seq
MIRT2001916	hsa-miR-3649	CLIP-seq
MIRT2001917	hsa-miR-3665	CLIP-seq
MIRT2001918	hsa-miR-3677-5p	CLIP-seq
MIRT2001919	hsa-miR-3678-3p	CLIP-seq
MIRT2001920	hsa-miR-3679-3p	CLIP-seq
MIRT2001921	hsa-miR-371b-5p	CLIP-seq
MIRT2001922	hsa-miR-3922-3p	CLIP-seq
MIRT2001923	hsa-miR-3925-3p	CLIP-seq
MIRT2001924	hsa-miR-4264	CLIP-seq
MIRT2001925	hsa-miR-4267	CLIP-seq
MIRT2001926	hsa-miR-4297	CLIP-seq
MIRT2001927	hsa-miR-4435	CLIP-seq
MIRT1019454	hsa-miR-4456	CLIP-seq
MIRT1019455	hsa-miR-4492	CLIP-seq
MIRT1019456	hsa-miR-4498	CLIP-seq
MIRT2001928	hsa-miR-4512	CLIP-seq
MIRT2001929	hsa-miR-455-3p	CLIP-seq
MIRT2001930	hsa-miR-4632	CLIP-seq
MIRT2001931	hsa-miR-4648	CLIP-seq
MIRT2001932	hsa-miR-4651	CLIP-seq
MIRT2001933	hsa-miR-4676-5p	CLIP-seq
MIRT1019457	hsa-miR-4690-3p	CLIP-seq
MIRT2001934	hsa-miR-4691-5p	CLIP-seq
MIRT2001935	hsa-miR-4726-3p	CLIP-seq
MIRT2001936	hsa-miR-516b	CLIP-seq
MIRT2001937	hsa-miR-520a-5p	CLIP-seq
MIRT2001938	hsa-miR-525-5p	CLIP-seq
MIRT2001939	hsa-miR-541	CLIP-seq
MIRT2001940	hsa-miR-575	CLIP-seq
MIRT2001941	hsa-miR-603	CLIP-seq
MIRT2001942	hsa-miR-608	CLIP-seq
MIRT2001943	hsa-miR-654-5p	CLIP-seq
MIRT2001944	hsa-miR-657	CLIP-seq
MIRT2001945	hsa-miR-663b	CLIP-seq
MIRT2001946	hsa-miR-761	CLIP-seq
MIRT1019463	hsa-miR-762	CLIP-seq
MIRT2001947	hsa-miR-764	CLIP-seq
MIRT2001948	hsa-miR-766	CLIP-seq
MIRT2001949	hsa-miR-939	CLIP-seq
MIRT1019448	hsa-miR-138	CLIP-seq
MIRT2001906	hsa-miR-24	CLIP-seq
MIRT1019454	hsa-miR-4456	CLIP-seq
MIRT1019466	hsa-miR-1207-5p	CLIP-seq
MIRT2001896	hsa-miR-122	CLIP-seq
MIRT2234964	hsa-miR-1224-3p	CLIP-seq
MIRT2234965	hsa-miR-1227	CLIP-seq
MIRT2234966	hsa-miR-1231	CLIP-seq
MIRT2234967	hsa-miR-1267	CLIP-seq
MIRT2001898	hsa-miR-1294	CLIP-seq
MIRT2001899	hsa-miR-1296	CLIP-seq
MIRT1019448	hsa-miR-138	CLIP-seq
MIRT2001900	hsa-miR-140-3p	CLIP-seq
MIRT2001902	hsa-miR-1915	CLIP-seq
MIRT2001906	hsa-miR-24	CLIP-seq
MIRT2001908	hsa-miR-2861	CLIP-seq
MIRT2001909	hsa-miR-3136-3p	CLIP-seq
MIRT2234968	hsa-miR-3147	CLIP-seq
MIRT2234969	hsa-miR-3151	CLIP-seq
MIRT2234970	hsa-miR-3170	CLIP-seq
MIRT2001911	hsa-miR-3185	CLIP-seq
MIRT2234971	hsa-miR-342-5p	CLIP-seq
MIRT1019450	hsa-miR-361-3p	CLIP-seq
MIRT2001918	hsa-miR-3677-5p	CLIP-seq
MIRT2001925	hsa-miR-4267	CLIP-seq
MIRT2234972	hsa-miR-4284	CLIP-seq
MIRT2234973	hsa-miR-4425	CLIP-seq
MIRT2001927	hsa-miR-4435	CLIP-seq
MIRT2234974	hsa-miR-4436b-3p	CLIP-seq
MIRT2234975	hsa-miR-4450	CLIP-seq
MIRT2001928	hsa-miR-4512	CLIP-seq
MIRT2001932	hsa-miR-4651	CLIP-seq
MIRT2234976	hsa-miR-4664-5p	CLIP-seq
MIRT1019481	hsa-miR-4763-3p	CLIP-seq
MIRT2001936	hsa-miR-516b	CLIP-seq
MIRT1019461	hsa-miR-548v	CLIP-seq
MIRT2001942	hsa-miR-608	CLIP-seq
MIRT2234977	hsa-miR-654-3p	CLIP-seq
MIRT2001945	hsa-miR-663b	CLIP-seq
MIRT2234978	hsa-miR-760	CLIP-seq
MIRT2001947	hsa-miR-764	CLIP-seq
MIRT2234979	hsa-miR-892b	CLIP-seq
MIRT2001949	hsa-miR-939	CLIP-seq
MIRT2001949	hsa-miR-939	CLIP-seq
MIRT2234964	hsa-miR-1224-3p	CLIP-seq
MIRT2538765	hsa-miR-1260	CLIP-seq
MIRT2538766	hsa-miR-1260b	CLIP-seq
MIRT2538767	hsa-miR-1280	CLIP-seq
MIRT2001899	hsa-miR-1296	CLIP-seq
MIRT1019448	hsa-miR-138	CLIP-seq
MIRT2538768	hsa-miR-185	CLIP-seq
MIRT2001902	hsa-miR-1915	CLIP-seq
MIRT1019470	hsa-miR-2277-3p	CLIP-seq
MIRT2001908	hsa-miR-2861	CLIP-seq
MIRT2538769	hsa-miR-3150a-3p	CLIP-seq
MIRT2538770	hsa-miR-3175	CLIP-seq
MIRT2001911	hsa-miR-3185	CLIP-seq
MIRT2001913	hsa-miR-346	CLIP-seq
MIRT1019450	hsa-miR-361-3p	CLIP-seq
MIRT2538771	hsa-miR-4306	CLIP-seq
MIRT1019454	hsa-miR-4456	CLIP-seq
MIRT1019474	hsa-miR-4462	CLIP-seq
MIRT2538772	hsa-miR-4487	CLIP-seq
MIRT2001928	hsa-miR-4512	CLIP-seq
MIRT2538773	hsa-miR-4644	CLIP-seq
MIRT1019457	hsa-miR-4690-3p	CLIP-seq
MIRT2001939	hsa-miR-541	CLIP-seq
MIRT2001943	hsa-miR-654-5p	CLIP-seq
MIRT2001949	hsa-miR-939	CLIP-seq

Show/Hide all (84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0001771	Process	Immunological synapse formation	IEA
GO:0001957	Process	Intramembranous ossification	IEA
GO:0001957	Process	Intramembranous ossification	ISS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	15182672, 15383276, 16169070, 16628223, 16717130, 16787945, 18369319, 19041750, 21295525, 21706016, 21900206, 23108400, 23455922, 25852190, 27012601, 31980649, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005768	Component	Endosome	IEA
GO:0005813	Component	Centrosome	IDA	27012601
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA
GO:0005925	Component	Focal adhesion	IEA
GO:0007420	Process	Brain development	IBA
GO:0007420	Process	Brain development	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IBA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9826657
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031267	Function	Small GTPase binding	IBA
GO:0031267	Function	Small GTPase binding	IEA
GO:0032012	Process	Regulation of ARF protein signal transduction	IBA
GO:0032012	Process	Regulation of ARF protein signal transduction	IEA
GO:0032013	Process	Negative regulation of ARF protein signal transduction	IEA
GO:0032465	Process	Regulation of cytokinesis	IDA	23108400
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	ISS
GO:0036465	Process	Synaptic vesicle recycling	IBA
GO:0042802	Function	Identical protein binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043015	Function	Gamma-tubulin binding	IDA	27012601
GO:0044305	Component	Calyx of Held	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	ISS
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045820	Process	Negative regulation of glycolytic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048666	Process	Neuron development	IEA
GO:0060076	Component	Excitatory synapse	IEA
GO:0060077	Component	Inhibitory synapse	IEA
GO:0060996	Process	Dendritic spine development	IEA
GO:0061743	Process	Motor learning	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0090063	Process	Positive regulation of microtubule nucleation	IMP	27012601
GO:0097110	Function	Scaffold protein binding	IEA
GO:0097431	Component	Mitotic spindle pole	IDA	27012601
GO:0098793	Component	Presynapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IBA
GO:0098794	Component	Postsynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098794	Component	Postsynapse	ISS
GO:0098879	Function	Structural constituent of postsynaptic specialization	IEA
GO:0098880	Process	Maintenance of postsynaptic specialization structure	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0099645	Process	Neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA
GO:2000646	Process	Positive regulation of receptor catabolic process	IEA

MIM	HGNC	e!Ensembl
608434	4272	ENSG00000108262

Q9Y2X7

Protein name

ARF GTPase-activating protein GIT1 (ARF GAP GIT1) (Cool-associated and tyrosine-phosphorylated protein 1) (CAT-1) (CAT1) (G protein-coupled receptor kinase-interactor 1) (GRK-interacting protein 1) (p95-APP1)

Protein function

GTPase-activating protein for ADP ribosylation factor family members, including ARF1. Multidomain scaffold protein that interacts with numerous proteins and therefore participates in many cellular functions, including receptor internalization, f

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01412	ArfGap	1 → 120	Putative GTPase activating protein for Arf	Domain
PF12796	Ank_2	137 → 229	Ankyrin repeats (3 copies)	Repeat
PF08518	GIT_SHD	264 → 292	Spa2 homology domain (SHD) of GIT	Family
PF08518	GIT_SHD	328 → 356	Spa2 homology domain (SHD) of GIT	Family
PF16559	GIT_CC	409 → 474	GIT coiled-coil Rho guanine nucleotide exchange factor	Coiled-coil
PF12205	GIT1_C	638 → 754	G protein-coupled receptor kinase-interacting protein 1 C term	Domain

Sequence

MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ

Sequence length

761

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Regulation of actin cytoskeleton Epithelial cell signaling in Helicobacter pylori infection		Ephrin signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIT1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	36994687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	21499268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32233750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	21499268		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	22897819, 28948080, 33115496	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21499268, 22897819, 29554125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CTD_human_DG	21499268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11401523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	29147966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21308737, 24608434, 29270025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24608434, 35318302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	29942122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37943661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23325601, 25794709, 26188902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36994687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36994687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24040099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24040099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23325601, 24040099, 25794709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29912587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12480822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27363808	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	22897819, 28948080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36994687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15569830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	15383276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	22897819	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	29554125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28977838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25794709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26462147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37943661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24608434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21308737, 24608434, 29270025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11401523, 12480925, 12584203, 30417466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28759023, 29231252, 31478245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12480925, 22807447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24040099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	30655777		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24265417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36994687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	21499268		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Minimal Brain Dysfunction	Minimal Brain Dysfunction	CTD_human_DG	21499268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11401523, 24265417, 29270025, 30555255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27363808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30555255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32945076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20091141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11401523, 12480925, 12584203, 30417466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30417466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27457813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28759023, 29231252, 31478245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31832002, 33752480, 36418900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GIT1 (GIT ArfGAP 1)